SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA05314 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA05314
Domain Number 1 Region: 1900-2159
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-43
Family YWTD domain 0.00000695
Further Details:      
 
Domain Number 2 Region: 57-324
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-36
Family YWTD domain 0.00000487
Further Details:      
 
Domain Number 3 Region: 1080-1311
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-29
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 4 Region: 2774-2960
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-16
Family YWTD domain 0.00079
Further Details:      
 
Domain Number 5 Region: 406-598
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-16
Family YWTD domain 0.0028
Further Details:      
 
Domain Number 6 Region: 745-944
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000275
Family YWTD domain 0.0041
Further Details:      
 
Domain Number 7 Region: 1400-1445
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 8 Region: 9-50,332-367,637-689
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000942
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 2383-2420
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 10 Region: 1443-1480
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 2208-2242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 2293-2335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 1543-1580
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 2606-2642
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 15 Region: 1583-1623
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 16 Region: 1720-1754
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000995
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 17 Region: 1635-1671
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 18 Region: 654-688,993-1075,1312-1374
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000282
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 19 Region: 1495-1527
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000995
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 20 Region: 2249-2294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000102
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 21 Region: 2337-2379
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000301
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 22 Region: 1366-1404
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000668
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  CJA05314
Domain Number - Region: 2473-2491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000288
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number - Region: 2529-2561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00144
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number - Region: 1858-1896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00155
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 2498-2521
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00301
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 3045-3077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 2569-2602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00877
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number - Region: 1777-1803
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0432
Family LDL receptor-like module 0.0042
Further Details:      
 
Domain Number - Region: 1683-1715
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0589
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 2429-2456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0589
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA05314   Protein: JA32717   Gene: WBGene00124518
Sequence length 3077
Comment JA32717 WBGene00124518 locus:Cjp-lrp-2 status:Predicted
Sequence
MFLGKDDRTCEKKDPCRFGQCSQLCVPHGSRHFCYCADGFKLGTDGFSCLSDDPEKPILI
FTNRHEIRMIQSKFPGSTPLISKLTNAIALDFRYHQNGSLSIYWTDLSADRIYTGLVERR
SILYTRTIVSYGVFNAEGIAVDWITGNVYWIDSTLHTIQVASDDGTKRATVINENMGNAR
ALAIDVQEGLMFWTDWQESKPRIERATLAGKKRAEIWKILNAEQAGWPNGIACDTIARRV
YWVDAKSDSIHTVTYEGADHVVVFRDAERLGHAFGIDVFEGHVYFSDWRTNTISKVDKWH
GGNVSIIERVTTQPFSLKIVHRSKQKMQLKNPCDGVKCNGICLQNGKDQAACQCTNLQST
EDDGCVNIDQTLLIVTKTSIRGFSTTPPHPHAFPMVAGKQFESIKAVGAFGNRLQVLDSV
TNQVALVNLTAPSQDEQVLMMAGSDLYGVSGMTIDPLFGNTYLAMSTDGIGRIEVINAKG
NAKKVLVESEGMKLPRDIVFLSSTLYWFDDATRPPTLYSMPANSGPRKHQLNSTLLEKAF
NPVVDTINSKLYWVSMGRVVQFDADNLKIEEIEIPGGDGNVTAIAVDQQNGDILIGEFVR
IANQTTVRRLAMKGKKAIQRGSVMLVPLHASEKYFLATIDTAQKAPAPKLPEACQSCPDS
LCLSTTSSSYGCVCSQGFVMDASKKTCQPPEKRVFWAADDGTLHSVGWYGSEQKIRAHSL
HSSIAKKRIVRIAIWYVNKDIQYRIYAVTRQNEVWQCATNGSFARIVYTTNSHRIAAITV
DRVTGYLLVSARESVSTKGVIVLVDADRHADGMYAVIVEDEEKVPYEIAVDPPKGYAPIF
YEIHSEMKNFRKLFWASAHCIKSSNYDGSDVKCIVSKSQISTIAIDEDSSRLCYMDSEKA
AVDCVDYNGENEQRNVAMFKPQGLGEMVNFAINGDELFFFDKFNMSGSIVRGVRQRDGTF
LLVDSVVKTSPRQKLRVNDMEVMDVKNSVLYTACSNNNGGCEHLCITTASESSTSSKNAV
KKECVCVHSVRGDDGTCVPSRTFLAFARHLTIDFVSARPEDLAPPNRQIGSQQCAISKNV
AIAADAGRGRVYFADFDKLRISAANFDGSGCVVIAEDVGVVASMAYDEVHRELYFVRTYP
ASIWRLDLADNNLETYPTEPRIVLALTVRDRPRHIVVHPCRMLIFFTNNAVTGSVLERVY
YSGYKREMVLQEDLHDVRGLAIDLDAEKLYFSDAKDFKVSRCDFDGTHREMVVSNSDISS
IHPFELAILDDEIFFTDWVRRSVGSVNKITGNENRTVTRGTELPIGLVVVDVDREYCGSD
PCSGDEMKCGDYCRLKADGQPSCACNGERRLNSDNRTCTGDADSKKCAENEFKCLHFDRC
INYEETCDGYNDCPIHDDEDEIYCSTRSCRPGYFACGNGLCIPESKRCNRKNDCSNFADE
ANCTCSEEEFRCSTGACIPLRARCDHTQDCADASDEIGCPFRNCSELNEFGMTGLVNCPT
TSQCILPAWKCDGRDDCFDGWDEKDCSVEFDATRTSVGPPGKCDTKTQFVCATTRTCMPK
HWQCDGQEDCGDGSDEKNCNQKMRQCTSYEFQCVSSPNKSCIPVENRCDGQTDCPNGEDE
VGCQTEECGGAETNATFRCTNHRCIPMAWRCDGTDDCMDNARSLGSDEVDCGDGKTSMHL
PSHCADESCTVACELTAVLCDGIRDCDSGFDEENCASLDRSCKKNEWMCNSGQCIDSGRL
CDASVDCIDGSDEWVEICSLSEPPKRGCANGWSCVLKNGTIGCLEEKQLCDGERDCMSGI
DEHCQIPQGNCSSTKNSCEQPWNCQRKAGFETCSCDDGFHLSPYDQSSCLRLPSCPKANC
SHFCIDRRDVGHQCFCASGYILSENGRDCRRNDTIEPEILLVYGHRLKLFSIDGHSKATL
LSNLTNGVALDYDIKSDLIYWTDVTHSGNKAGITSMSNQPNTYKVITSLPTKGIDGIAVD
WLGRNIYYTDRNHDAIGVCDMRGRFNRILLKGTPLNDPRAIVLDPLHSLLFWTDWGASAH
IGRMNMDGSQEQVILQDRTIRWPNALAVDAPAQRLYFGDAHRDFIASCNYDGSKRRMVLR
NAVRHIFALAIFEDFVYWSDWHNHTIERAHKITGDHRKVLIHDKYYRPMGFKIVHPSLQA
MGSLKTARHPCSQPARCDNLCIPSSGTEDFTCMCAQGFRSEGRSCVSECKPNDFICTKTY
KCIAPWWRCDGQDDCGDGEDEGYFVKGVCPPFPCDAGQFACSGTSNNATCLYASQLCDGN
KDCPHGDDEKPEFCANFECTESQFKCGDKNKCISLIAVCDTKNDCDDGSDEKDCTITDCG
PDFFACVNHTTSAISQCIPKGFYCDGEDDCVDGSDEPDTCYGMGECTHEQFQCASGKCIP
RRQRCDGDLNCRDASDERGCDNDCALVCDDFCVHADELCNGNKKCSDGSDEDELACTTKR
LLETKASRRCGGFACDGIVDCADGSDERGCPSLDCHLHLNMSLICDGKVDCDSGRDEQNC
LSHMDYHNQPFQCTKQNVKEWQVCDGRWDCADGFDESPEMCKSRTAKCSRIGRCDNKKQC
LDVSTALCDGVKDCSDGSDEAFAHCREMCRGMFRCSNGRCIQPNLRCNGRDDCGDGTDED
TCDTKCHHFGTCAQRCWIAFNTTARCHCAPGYSRTKADMFGCEPLSKSTEMFLLNGKQIH
LIAVDNSQLTTVWNTKLNFIPGGIDFAYDLFRASLMYTVELGAGSFNPHEVEIRSQSWSE
GDAKNPWGNEDDKSTAALLAYDFMHNNVYFTESGDPDNEVVFNYQENIYVARARDTRTRT
LIVNSTGSITSLSVDPLNRLIFWTTGGPVPRILSAHLDGTPIPQPFKPSSSQPHLALVER
NIFDPKSLVIDTPNERIYWIDGFKRTIETVTLDGKDRRTVRKFELGDQPVVMDILGSYIY
LVTNQGSLVKMHKFTGKIEKYTQKVRDISPRMKLRIAHPAKHTVSHIAHQKNPCQSSYCP
SETVCVPMADKNGQLIPKCLCGAGRFFEVSTKKCLRLREKDQEASQCGDYFCYNNAYCSS
TLKQCICPPGFYGRQCE
Download sequence
Identical sequences 281687.CJA05314 CJA05314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]