SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA07083 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA07083
Domain Number 1 Region: 19-85
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000504
Family Spectrin repeat 0.0077
Further Details:      
 
Weak hits

Sequence:  CJA07083
Domain Number - Region: 175-312
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000408
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number - Region: 87-146
Classification Level Classification E-value
Superfamily Peptidoglycan deacetylase N-terminal noncatalytic region 0.0366
Family Peptidoglycan deacetylase N-terminal noncatalytic region 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA07083   Protein: JA18272   Gene: WBGene00126287
Sequence length 494
Comment JA18272 WBGene00126287 status:Partially_confirmed
Sequence
MDNIIENRITPVLFIAPFQIADNVDEAESLVKQHEELTTKTREIEEQSQQLAEMATRLMA
ACPQVAIVLQKTREQIRDVAEHFAYRVEAQTQFALSNRNFRAKVAEFSKKSDLMLEKVCA
EDDNSAKTLEELTKNKKELEDSLNSMNVAFEAAMDAGEETVVKTRQYGEVLPCEEFIAHI
GSSLSYISQRQNRHNELASVKRLEQQQQVQLLTTYGDCDQAIKWLAELKETLHKDYSLSD
VNEEAVRHLRNDRQNLDRTALSTYQYGKQLLSMAKNTERAAMKESSSDERHEKLESAWRE
LDEAIRQNEARLKVVESFMVTHRQMMERVSEIDKSLRERLRVSGRLNSITLSTERRRLKD
DIEELSSIGRMLSAQINADHSTTPEDRQSAMKQIADKIEQVKSAERRMESLIGEEEEATS
SSSGKEDKVNLQILFNYLFFLLQPSSTRRVRPLSKVPEEEGGEVSPVLPRAVRLLESTEG
ITPAIRLSKNESYL
Download sequence
Identical sequences 281687.CJA07083 CJA07083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]