SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA07350 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA07350
Domain Number 1 Region: 4-388
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.34e-28
Family Reverse transcriptase 0.013
Further Details:      
 
Domain Number 2 Region: 696-824
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000379
Family Retroviral integrase, catalytic domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA07350   Protein: JA34332   Gene: WBGene00126554
Sequence length 867
Comment JA34332 WBGene00126554 status:Predicted
Sequence
MKDDSLTTKLRIVLDASSHMRENISLNDCLHAGPSILQSILGIMLRARLSNYLLVADIEK
AFHQVRVQDEYRDVTRFLWLKNPEREATPENIVTYRFSRLPFGVSCSPFLLAVTILMYLE
INPNEINERIIKNLYVDNVMITTNEEQELPKIYKATKQIFEKMGMNLREYQMNSQKTRQS
IPEADRAREETVKLLGHLWDCNDDTITIKIPKPPEGVPTKREVVSFLASIYDPMGILSPI
IVPIKELTQDLWEEEVSWKEKIPLRITKKWEAIKTTFKQTSYTMPRRLVSVANYKAVQLL
LFSDASERHFATAAYLHFQFENSTPVTKLIMAKSKVKPKGTELSIPRLELMAIEIAVNAA
MTLTQELELKKLSNIKFFSDSMIALYWVLKREKLTKFVDNRVSKIHTIARSLKEQNLKPS
FHHCPTDQNPADIASRGSTIDKLMGNVLWEEGPEFLKRPENEWPIRLEGTINYPSEFRDL
IEKEVTWKKPIKANTKKATVLTIAETTIQQDSIVRYKSARSFEKLITTMSMVFRWYTRKL
SNKKWNSRLMKKLAESNTDEISRRSLVRDFVIADHYRDQERKGIPIPQKLNLIKEESGIL
RHPRNLKRSELPQETKEPIFLMREHDLTYLIVRDIHRENAHLPASYMAGAVYRKYWILKV
GKIIQKVTQLCYKCKKQSGQPFQYQYSKNLPECRTTPAAPFRHVGLDYFGPIRYTNVLNK
SAKTWVLLVTCLVTRAVHLELVTDNSTITYLLALKRYFGRRGVPKSILCDNAPGFILGNK
MVNDDIRNNIHSSETLTTFLASREIQLKYITPLSPWQGGVYERITFVQHSLFCFPRSSVL
KVRLLAVTFCSAIYVLSAPSSFLQSLP
Download sequence
Identical sequences 281687.CJA07350 CJA07350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]