SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA10513 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA10513
Domain Number 1 Region: 49-144,236-346,451-599
Classification Level Classification E-value
Superfamily L domain-like 1.38e-34
Family Leucine rich effector protein YopM 0.025
Further Details:      
 
Domain Number 2 Region: 724-845
Classification Level Classification E-value
Superfamily L domain-like 3.29e-27
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 3 Region: 998-1148
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.71e-17
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA10513   Protein: JA36157   Gene: WBGene00129717
Sequence length 1173
Comment JA36157 WBGene00129717 locus:Cjp-tol-1 status:Predicted
Sequence
MRRKTPYFCLFLLILFNFLLFFICGVHAAETPFDDTSDCPKFCKCAPDAVQPTAKLVICD
YSSNSSTPISPIASAYRQNQQVANIRSLFISCDGPAHFPETYFKSLTSLHHLRVVGCSTT
HFAVKTFEDLASLRTLELSRMSAESSSFEMTEDVLMPLARLEKFSLTESRHVELPLRLLC
SLPHLQRNFRKPRGGALNLEPHLLSIIYKNFNDALRDDDAGDDPGVLNLSSNSLPTLRRE
ESCVAQQLLIVDVSRNQLSSIEQFVRGVPAIRQISVAHNLIAKLELATSTPFLQQLDAEQ
NKIETLESLPDTVVHVNLAGNLLKTIPVSVAALANLVALNVSRNAIELGNFSVLGEFFHH
LNWKCSTHARPLLEPPSSVCRRCPAKRLENQRPSPGQQLAGNARATLAGRPQTRNPGFVA
QSAHRGAGRDGKILSFPKIRKKKSKLSSFSESLDEGLTEASGLRRLDVSENAIVVLKWST
LPENLEFLNADKNDINLLTAALKSNLKTVSLSRNKITVLNSEQIPKTVESFDIAHNRLSR
LGKATLADKSQLRRLNLSHNQLTVVPTEAVRVMESIHPVKISIDNNPLECSCQSTWFVSS
ESEKKKEGSRVLIEDRHTAKCSHAVDGRIISLDRIQKKDLLCSYQSVCEPECICCQYGNC
DCKSVCPSSCRCFRDDTFNINIVRCEHNETIVPKREFVVSELPVSATEIILSGVVLPQLR
THSFIGRLRLQRLHINGTGLRSIQSKAFHTLPSLKTLDLSDNSLLSLTGDEFLKTSEVAQ
LFLNGNRFSTLSRGIFEKLPNLKFLTLHNNSFEDIPPVLSNVASLSGISLSSNPLRCDCG
VNVRHYNTKHNPYAAPIIEHNAAEWMSVYRHLVVDAAKVECRENVTKAFMINDTTILSAY
PPNVDRDIFVMPMDTFLRDYNVSICVPYSSGFFGQDPQNSVLFVLAAVAIAILLCILVIL
AISFVRKSHDAINQRRYKASSLNCSTSAGSSPLPIPLLSYHAFVSYSKKDEKMVIDQLCR
PLEDEDYQLCLLHRDGPTYNSNLHAISDELIAQMDSSQCLILVLTKHFLENEWKTLQIKV
SLFCILWSLTSHQLFAKNRAKRVIAVLGEGVDANLLDDELGQILRKHTRIEMRSHLFWTL
LHSSLPSRLPLPPHDDSSQLYSDIYGIVPSDVV
Download sequence
Identical sequences CJA10513 281687.CJA10513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]