SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA12330 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12330
Domain Number 1 Region: 269-423
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-29
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 2 Region: 1208-1342
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-29
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 3 Region: 817-957
Classification Level Classification E-value
Superfamily Spectrin repeat 6.96e-29
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 4 Region: 1504-1659
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-27
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 5 Region: 717-850
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-27
Family Spectrin repeat 0.00019
Further Details:      
 
Domain Number 6 Region: 378-525
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-26
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 1932-2083
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-26
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 8 Region: 1403-1538
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-25
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 9 Region: 1828-1961
Classification Level Classification E-value
Superfamily Spectrin repeat 2.74e-25
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 10 Region: 533-636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-22
Family Spectrin repeat 0.00024
Further Details:      
 
Domain Number 11 Region: 1100-1236
Classification Level Classification E-value
Superfamily Spectrin repeat 8.47e-22
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 12 Region: 2090-2203
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-21
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 13 Region: 1630-1734
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-20
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 14 Region: 601-714
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-20
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 15 Region: 1035-1103
Classification Level Classification E-value
Superfamily SH3-domain 9.32e-20
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 16 Region: 1734-1835
Classification Level Classification E-value
Superfamily Spectrin repeat 3.67e-18
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 17 Region: 958-1033
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000142
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 18 Region: 2297-2369
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000347
Family EF-hand modules in multidomain proteins 0.019
Further Details:      
 
Domain Number 19 Region: 22-91
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000127
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 20 Region: 127-218
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000209
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 21 Region: 2206-2287
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000196
Family Spectrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12330   Protein: JA33896   Gene: WBGene00131534
Sequence length 2370
Comment JA33896 WBGene00131534 status:Predicted
Sequence
MSDSNDAHDPPEPEIQILDTVHNIQQRRQEVLGHYSVFKSHSETKRERLEEARQFQYFKR
DADELNAWILEKLQTAQDENFRDPSNLQSEILSKNAKITPEHVQKISDQNIDFFFENFQH
RYFGLKLSAKIQKHAAFEAEVNAHATAIANLDDAGNAMIHYENFASDIIKVFLFVARLSL
LFIIFQKRLAELHALWKKLLFKLKDKGIKLQQALDLLHFTRQCDEILYWIREKETNVIAD
DISLDLEHVVILQQQFNDFSKELGNQRYRIDEINQAADSLVAKRHAEHEQIQKKRDDVNE
AWHHLNTLFATHKEGLFGAQQVQRFNRDADETLVWIGEKNFALSTDDYGRDLNSVQFLER
KHEGIERDLAALGGKMLQLEKEAAKLVETHPERADAIHQKNNDVLTAWNALKEKAQQRKS
GLENSFQLYRFLDDYRDLISWARDMKAVIEADELAKDVAGAEDLLGSHQEHKGEIEARED
SFSQTIIAGQKLIDMGMTDSSDIPEKLEELEHEKSSLLALWEQRHVIYQQCMDLQLFYRD
TEQAESWMDKQEAFLANTDLGDSLDSVEHLVKKHKDFEKSLTAQEVKINALDEFATNLIL
QHYAADEIATRRQALIDRRARILETSLQREKSLADSYRLQTFHRKCDEVVGWITEKLSIA
REESHLDPNNMRGKLQKHINFEQELKANENRLDDIGSTGEKLIESGHFATENVESFQIKD
RLRQMNSLWNDLVEAVKEKGIMLHAAKNEQEFNRIIEEVDTWLSDVEAQVASEDYGNDLV
SVQNLQKKIGLLESDINAHSDRLDGIKSIANQFESEEHFNASAVVRRQEDLQQRYNALRE
PLELRKRTLGESLQGNQLFRDIEDELTWIREKEQVTESINRVHDLIGVQNLIKKQEALIA
EIENHDDQVDSVSSTANEMIEQSHFLAPQIREQLAKLCDNWKMLRTKAEKRREVLEDSLQ
AHQYLSDANEADAWMNEKEPIIGSTDYGKDEDSAEALLKKNRALLSDLEAFKTTIEDLRK
QASQCKYQKEPERQFGRDSVLALYDYRDKSAREVSMKKGDVLHLLNDNNKDWWKVETNGR
QGFVPSAYVKRIEPGTVIQQANWIDQTQSEIEIKYEHLIELGETRNRKLDEACKGYQLLR
EVNDLSEWIKSREAFVVQQEVETDLEHVEVLQKKFDDFKEDLKANEARLQEMNQIATALT
SVGQPGAAIRIRQQIEHLNIRWRTLEEQTEQREHQLGSAQEVQRFHRDADETRDWIREKD
DALDSTDLGRDLRSVQALQRKHEGVERDLAAVEGKIKSLDDKANRLRQSHPEAAEQIYDR
QRELSEQWNHLIVKVNNRKENLYNSYDYQHFLSDYRDVMQWIASMDQLVFSQELADDVTG
AEALLEQHQEYRTEIDSRATTFQAFEQFGNQLINSNHYAVADIEDRLQSVETARKGLEDA
WVARRYVLEQCLDLQLFYKDCDQADAWISAREALLDQEDPSANSFESLIKKHKEFDKAMS
TQEDKIEGLTRFAEVLIKNNHYDAEAISIKGNEILERWIKLKEAFNQKRSKLGESQTLHQ
LSGDVDEIETWITEKFEIAQEENYRDTVNIQLNHQKQQAFEAEINANSERIAAIIQAANK
LIEKAKGTEDEPAISARLETISYQWSRLIEITTEKSYRLTEANKQNNFMEGIKELEFWLD
EIENRLQSDDYGKDLASVENLLKKHSLLEAEIIGHQDRVVEMNEQADSLLENDPQVDGRR
NLIADRYDDCKKMSADRRDKLSKARNVHRFFRDIDDEELWIKEKKLLVTSDDYGRDLPGV
QNLRRKHRRIDTELASHEPQISLIKLKGEELLRSADEAGIGQDQIKKRMEDLENGWKQIR
DLAGSRHHRLDESEAFQAFLEDVEEEEAWMNEKQQILRSGNFGDHVTGVQGLLKKHDTFQ
VDLELHKHRVVDLIKEGDALIHNGNHHAPHIKQRSDQLRARLVEIENMAEKRLAKLRDNS
AYLQYMWKCDMVESWIAEKEQHVRFQDFGRDLSSVQSLLTRHEAFEAGLNVFEQEGIKRI
SELKDQLVSSAHQQSKTIENRHTNVIQRWNNLLAHSETRLQNLLKMMKKFKQIEELHLSF
SQKASTFNSWLENAEEDLTDPVRCNSLEEILALCDAHEQFHRSLSSAEEEILQLQDLDRR
ITSFNVGPNPFTWFTMDAFEDAWRHLLKIVKEREMELAKELQRQKENDKLRHEFATLANA
FHTWLTNTRQEMMEAGGTLEEQLGAVEMKAREINGNKTQLRKIEEMGALLERNLILDNRD
VYVTLQEYMSFMISKETENIQSSEEIEMAFRALSKEFRPYVTTEELYANFTPEQAEFCMK
RMQPSTDTISSRTVQGGLHYEHFVHTLFQK
Download sequence
Identical sequences 281687.CJA12330 CJA12330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]