SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA13040 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13040
Domain Number 1 Region: 116-268
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-35
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 2 Region: 749-905
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-34
Family Spectrin repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 644-797
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-33
Family Spectrin repeat 0.0002
Further Details:      
 
Domain Number 4 Region: 538-691
Classification Level Classification E-value
Superfamily Spectrin repeat 2.03e-32
Family Spectrin repeat 0.0000811
Further Details:      
 
Domain Number 5 Region: 221-375
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-32
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 6 Region: 1466-1622
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-31
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 7 Region: 1365-1514
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-31
Family Spectrin repeat 0.0000301
Further Details:      
 
Domain Number 8 Region: 1256-1393
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-29
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 9 Region: 1571-1727
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-29
Family Spectrin repeat 0.0000366
Further Details:      
 
Domain Number 10 Region: 339-477
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 11 Region: 1895-2049
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-28
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 12 Region: 1170-1293
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-28
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 13 Region: 29-156
Classification Level Classification E-value
Superfamily Spectrin repeat 2.43e-26
Family Spectrin repeat 0.0000565
Further Details:      
 
Domain Number 14 Region: 1794-1927
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-26
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 15 Region: 2055-2169
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-24
Family Spectrin repeat 0.0002
Further Details:      
 
Domain Number 16 Region: 1061-1198
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-23
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 17 Region: 909-972,1054-1094
Classification Level Classification E-value
Superfamily Spectrin repeat 2.99e-20
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 18 Region: 982-1049
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-20
Family SH3-domain 0.0000615
Further Details:      
 
Domain Number 19 Region: 2279-2454
Classification Level Classification E-value
Superfamily EF-hand 8.8e-19
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 20 Region: 2171-2282
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-16
Family Spectrin repeat 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13040   Protein: JA38577   Gene: WBGene00132244
Sequence length 2456
Comment JA38577 WBGene00132244 status:Partially_confirmed
Sequence
MADSNDTHAPPEPVLEVPPPQEIRILETADDIQQRRQEVLGHYSLFKDHSKTKRDRLEEA
RQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLD
KTGNAMIQHNHFASDIIRKRLEELHALWDKLFFKLKDKGIKLQQALKLLHFIRQCDEVLY
WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH
DQIYKKRDDVNEAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY
GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAVKLAETHPDRADAIHQKNDDTKAAW
NALRDKAQQRKDGLEKSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH
QEHKGEIDAREDSFNQTASAGQKLVEMGIPESPEVRDKLEELAHEKATLLGLWEERRILY
EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI
NALDEFATKLIQGQHYAADDVAKRRQALLDRRRRLLDRARQRGNSLKESYKRQTFDRDCD
EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH
FASDHIGDRLRQVNSLWNELVDATNKKGAKLREAGNEQQFNRNIEDVELWLSELEGQVAS
EDYGKDLVSVQNLQKKIGLLESDFNAHNDRVDGIKNLAQQFESEEHFNAPVIVRKQEALH
QRYNALRDPLEKRKRKLGESLQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI
KKQQALIAEIANHDSQIESVSNAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR
GELDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK
GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNKDW
WKVEVNDRQGFVPAAYVKRIEPGTAQQHNKENNLRDKNIKFQVNSIGGKQSEIEDKYQRL
MMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDF
KGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALEEQTEQREQQLGS
AHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKS
LDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDL
QQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHY
AAADIENRLQGVNAARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQE
DPSGDNVESLIKKHEDFDKAINTQEEKIKGLKQFAESLIKNNHYDAPAVARKRDQILDRW
NGLKDALIQKRSKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQ
AFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYR
LKEANKQKSFMAAVKDLEFWLGEVEILLQSDDYGKDLASVENLLKKHSLLEADITAHQDR
VGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDI
DDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRS
AAEAGVGEDQIKKRMEDLESSWGQIRDLTGSRHKRLDESEAFQAFLGDVEEEEAWMNEKQ
QILGSDNFGDNMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIRQR
CDQLRARLVEIESMAEKRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSS
VQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSAHLQSPAIEKRHTNVIQRWQNLLA
HSEGRRQKLLKMQQQFKQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALR
DAHAEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKERE
QELAKEHQRQEENDKLRREFAKLANAFHTWLTNTRQEVGMMEAGGSLEEQLDAVKRKTSE
IKANKTQLRQIEEKGALLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQA
RNQSGVTEEALREFSMMFKHFDKEKSGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRI
LDIVDPNRYVQLALVKIKFMFFFSRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALS
KEFRPYVTAEELYANLTPEQAEFCIKRMKPYSDAISGRSIQGGLDYEQFVHALFQS
Download sequence
Identical sequences CJA13040 281687.CJA13040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]