SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA14369 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA14369
Domain Number 1 Region: 298-411
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-34
Family Calponin-homology domain, CH-domain 0.0000235
Further Details:      
 
Domain Number 2 Region: 759-865
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000249
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 3 Region: 418-526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000247
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 1112-1209
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000785
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 5 Region: 652-759
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000563
Family Spectrin repeat 0.0057
Further Details:      
 
Weak hits

Sequence:  CJA14369
Domain Number - Region: 936-992
Classification Level Classification E-value
Superfamily SH3-domain 0.000625
Family SH3-domain 0.0022
Further Details:      
 
Domain Number - Region: 1244-1285
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 858-937,993-1025
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0388
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA14369   Protein: JA23262   Gene: WBGene00133573
Sequence length 1311
Comment JA23262 WBGene00133573 status:Predicted
Sequence
MNCPDDSILAYILCLVHELVCFAFGISCSFPAAAERSEIARFREATEAETATYYRQRRSG
GGAEKATPLWTAAGGLSSSPTSSSSSFSSLFPTTSPSSSSSSSEEDTLATSTSTSTFYSS
NSHACDHCDSYVWHATACLATTALVLLGIATTLTMMKVVRSYSKKAERKSESSRGASQAS
SQQHQIQGGSSGAGAGGSQYYEEYHRGGGAGNGGVLTGNGNGYHHSLHSQQQQGGGQLMA
DNRHLSHAYQAHHGGGFSESSSYETREHFERKVQRVKKTRGERERSRSTRRDEVSEALHG
SDATSARDALLQWARKVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRPNIIDWNKISDES
VSNRERLDNAFAAAEKEFGVSRLLDAEDVDTNNPDEKSIITYVSSLYNALPHLPELNRLQ
NVQDEYIEEAREWREWVERATQLVDDRLLSGTASELIYELQRFRDDDLPARDEQKRRLCL
VYDHLEKSMRSTELFVIPRELSGLELQRAWNELLNAIERRFDVLERHRIQEGNSNDIISR
LERGIGITNEKLDLILKRIEDVEARIDTSPPAAVERTVSEIVDDLNVLENPIAGFFEDVE
ELKTMQHPEANEYYRRVYGLHQRRTVYLDRLTNQILVRLGVRTDSLHKENQQRLENIRQT
SFSRVEECIEWVRIRMEKLTTMEFLEDLETLEHMFEQHKLDNRDIQDFRQNVDECIARQA
EVSAEDTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSEREQIEV
TRNWSDIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAVRVIEIYLKT
MQTQWDWLLALSKCLEEHLRDALNLKSFMEEAADAEAFIEEQAIRLENNYNRTDFSLEEG
ERFLRELDETKDILNKYHQVLMALTERCATISPLWQRGERIPHPINVTALCDYADQNITI
KAGDDVVLLDNSDLIKWTVRDLSGVEGQVPSVVFRIPPPDARLTAFLNRLLQQFEKLKKL
WDKKHRTVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDVNKLLSELDPNDPL
ALRLREELRKTNEHFWNLLNASQKPPEPDWASQYDQKMSELLRKLEEAWRRLNDAVGKPI
SQSPEELERVIHEHKRFEDALQALDGDVSNVKELFRQLPNPTPTQRVNHDRLNGLWDDLW
DLSRMHVERIKAKIFDAKLGQYSDAIAGIHGSDVRQLFRRTKPQPKNGAQIVTEELELLN
RRFAQLSSLILERRNTLQVLIQNWKRQKQFFFVFYPSSKQNASPPEHPEPK
Download sequence
Identical sequences CJA14369 281687.CJA14369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]