SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA15488 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15488
Domain Number 1 Region: 370-798
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.13e-131
Family Reverse transcriptase 0.000021
Further Details:      
 
Domain Number 2 Region: 961-1122
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.2e-41
Family Retroviral integrase, catalytic domain 0.003
Further Details:      
 
Domain Number 3 Region: 80-180
Classification Level Classification E-value
Superfamily Acid proteases 0.00000375
Family Retroviral protease (retropepsin) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15488   Protein: JA28092   Gene: WBGene00134692
Sequence length 1288
Comment JA28092 WBGene00134692 status:Predicted
Sequence
MTGIAYLIIRKLGVSIGIFHVNTNSRRNSEELTTVCNVSAEPTAPEEDYQREVQPFLPRL
PPVMTYLPIVMAFVNTVGSSSLPYVPISLKDRLTVALWDSGSSISYLRKSTMMYINELKF
NKSVNQAATAANGSKFEFLGSTTLPIRIGSTHLETPFLISRDEHCPANVLLGFDFMAQLE
KIGVPTTLLPGQKKMIVGKSLVPLIRQGDRAYKHTRRIVNIVAASDTELKPGARQNLRIT
FDTDEPLHLRSVGKSPVRFNECIIDPWLENTANVTVINHGPTIRAIKEGETLGHARTVKR
PTFVANKSSDAITPVPQLINEETSPEADWTTKLPNPPASDDLFRKELDIKSSCLSHNNSD
KLIALIHRHETAFYNKDGSLGHFSGPIQHTIELDKPLPKPRKGRIPYSKREEVARQVEEF
RRLKIIEPSTSTFTSPIVLVKKKDSTFRFTVDYRTLNSATRKENYIIPHVAEILDLAANS
HVFSSFDFISGFFQIELRKEDRPLTAFETEEGTFQFRVMPMGVCGAPHTFQQVARYLQKN
VKAKLFAYLDDLLLVSQSEEEHLQDLDNLLTLISDCGLKLKLSKCCFARKELEFLGYIIG
RDGLKPNPKKVYAIQHYPTPIYPTAVRSFLGLVGYFRRFIANFAGIASPLHELTEKKNEF
VWTDEHQSSFDFLRQALLNPPILVGPNLTKPYIVECDASLMAVAGALLQKNDEKQIQVIA
YASRKLNPAERRYPPIEAEALAIVFCLQHFRQYVLGSHTVVITDHKPLTSLLHRKDLDGR
LQKYQLSIQDYDIEIIYRPGRHNVIADALSRYFEDETNEPAVHAVQLERSDVVTAEEVRE
AQNETEWIKDAIAAILDNADSRKGRSWRNRFTVRDGMLRQKHDNNTIIIPRDHPIKSHIV
KRYHESSIHGGHLAVEKTLDVIRRHFYWTNMRMDVQDAVRRCLPCQRRKTNPHDTTVEPS
GPVTRFSQPAEHWHIDHLGPLPITENGNRYVLCFRDAFSRYLITTPVQSQDSQTSSEEFI
KNIIAIHGTPTSVTTDHGTSFTSELFRTTLKDLGIEHIRSAPYHHQSNGIVERANRTLEE
SLSSYVNHHQTDWDAFLPLVTFAINSSTTVTTKNCPFEVMFGRKPTLPENNVLNIRTLFG
EDYTTNLRQRLHELWDQMRTLAEEQDHKTPGTKRRTLARDVRKGDLILVKRQAPKNKLAP
RLVGPCTVKEVTSKNVTFLLDGAERIAHKDDTRLFARTRQHEEEEEEEDDRPSPRSSPAS
GSPPPSRRSSTSYPIRRSARLQEKTNVK
Download sequence
Identical sequences 281687.CJA15488 CJA15488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]