SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA15519 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15519
Domain Number 1 Region: 17-245
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.36e-50
Family BAR domain 0.0032
Further Details:      
 
Domain Number 2 Region: 270-343
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000126
Family SH3-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15519   Protein: JA23446   Gene: WBGene00134723
Sequence length 344
Comment JA23446 WBGene00134723 locus:Cjp-erp-1 status:Predicted
Sequence
MDFNFKKMASEAGGFFSRAKQLTEETFLKAERTELDSHFENLLQRADKTEEHTRRLLSAI
EGYLQPNPTVRMEEVFYEKLELKKDGAVRLNNLENLSTAMTEAGEQFGETTPYGTALIKV
AQTENRLGQAERELCGQAATNTKILNSKRLDLDACKNRLKKAKTVDSQNMTNSKTSGGFT
VEQAEADVRVAQAEFDKQSEITKLLLEGIQTAHNNQLKCLRDFVEAQMSFYAQAHQLMAD
LQRELSGTMSFRGSLAILVNNSAEPPNGKPIPTATVKPALLSDDLGTKQAKVIMDYDAVL
PQEISVSQNDILIVYRLPGMDAEYVMAEKGGKRGKLPVSYIELL
Download sequence
Identical sequences CJA15519 281687.CJA15519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]