SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA15544 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15544
Domain Number 1 Region: 238-365
Classification Level Classification E-value
Superfamily PapD-like 7.06e-23
Family MSP-like 0.0036
Further Details:      
 
Domain Number 2 Region: 1-154
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.14e-22
Family CRAL/TRIO domain 0.0061
Further Details:      
 
Weak hits

Sequence:  CJA15544
Domain Number - Region: 157-213
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0471
Family Formin homology 2 domain (FH2 domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15544   Protein: JA05416   Gene: WBGene00134748
Sequence length 452
Comment JA05416 WBGene00134748 status:Partially_confirmed
Sequence
MYLHETDLQSRHILWIMMSKYKNGEDGFEKLFTFWMERHYMEYKGCQPLTVFIDMSGTGL
KNMSFDAMKFIIHSNKYYYPNAIESILIFENPAILNASWKVIGSWLESSAASQRHGLLTF
VTKLSVTHYVSKSHLLEHQGGTDTFKFTMDELAKCLPPPPPPKPSPKLLQQQRNSIDDTV
NNNVSEFDFSSFHKRNVKFDEESSVKRAPSLLSRRSSRGPTNRKSHIPPSLRPLIETRVN
APNDDWSSNDFVSITPRDELRLEKLDGENDLLDVVLVKNQSSDTPIMFKFKTTSPEKFRV
RPSSGIVQPGTTEIIKVYLQYEYRHSWSKEKFLLLTMESSSTDIDSFSDQFKTAVKKAEF
KFKCRLSDSVKLDQPEERRSSFLLQQQQQQKVEQRGININMPIIILFLFLLLLFQFFYII
QVRSDNSILRETLITLSSQLKENSVEAVKNEL
Download sequence
Identical sequences 281687.CJA15544 CJA15544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]