SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA19030 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA19030
Domain Number 1 Region: 189-422
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-77
Family SSRP1-like 0.00000464
Further Details:      
 
Domain Number 2 Region: 544-628
Classification Level Classification E-value
Superfamily HMG-box 3.14e-22
Family HMG-box 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA19030   Protein: JA10579   Gene: WBGene00138234
Sequence length 698
Comment JA10579 WBGene00138234 status:Partially_confirmed
Sequence
MNFSGLFVEDMGVLAPGQLNLTDQGLSFKGSKNVSAKASDMDEVRWQKLGNKPGLRFGMK
DGVSYRFGGFKDADYDKIADFAKENWSQSVEKTDLVIKGWNYGDIDVKGKNIEFNWEGKP
ICEIPCTAVSECVANKNEVFMAFNQRDDAPITLFEMRLHMPADEEGGVDAAEEFKKAVLA
FAGLEAETEQPIALLTDILCMTPRGRYDIKIFPTTIALHGKTYDYKIPIKSINRLFLVPH
RDGRHVNFVLSLDPPIRQGQTRYSYLVFEFDKDQRDDIELGLTDEQIKEMYNGALQRNMD
GPIYESISILFKIVCNLKITVPGKFIGNTGTPAIHCSHKQNPGHLYPMEKGFLFIHKPAM
YIRFDEISSCHFARSDGGTVTRTFDFEIDLKAGSSLMFNSLEKEENNKLYDYLKKKNLKI
RNAQRIDAKDLDSSDDDIDPYKAAVKAEGRQRMESDESDSTDEDYDLDKDLKKQKIEKDS
SEGSGSEPDDEYDSGSEQDSSGTGESEPDDEEDVRSSKKKQAKEPKEPKEPKEKKAKKEK
AAKPEKKGKKTKDPNAPKGASSAYILWFSANRLSLKKDGDSVADVAKKGGEQWKKLTAED
KKEWEAKAAKDKARYEAEMKEYRKNGGGGAAAESSKPSTKTSKKSTGPSPSKAKSKEYIS
DSDDSDEEEEPKKKKKSAPKEESGDDSNASDGSEDESD
Download sequence
Identical sequences A0A2H2INH3
CJA19030 281687.CJA19030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]