SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA21082 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21082
Domain Number 1 Region: 56-149
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 5.58e-17
Family ParB-like nuclease domain 0.0067
Further Details:      
 
Domain Number 2 Region: 142-203
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000366
Family KorB DNA-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21082   Protein: JA29369   Gene: WBGene00176654
Sequence length 331
Comment JA29369 WBGene00176654 status:Predicted
Sequence
MSRKNPFANLDLSSISSDKPAAKAGYGMTGAAKTVVRSIEEMAENTKRLMDGETIIEIEP
QLLDVSFAADRLSEDDDEFEALREAIKEQGQATPILVRPNPNNSERYMVVFGHRRARVAM
DLGIRVKAVVKKLDDISSAIAQGQENSARSNLSFIERAYFAQNLLSSGMGKDIVKSAIGI
DDALLSKMLSVVETVPSTMIMAMGASKKIGRDKWLSLRQIILNPAHLDVALSRIASVGFM
ALPEEERFDALHEYLKKYSVRSAAKAPAKVTTEKSWASEDKAVRFLMKQKPKNVAIELSS
AEARPFSDWLSSNMDRFYTEYKQSKPQSSGD
Download sequence
Identical sequences 281687.CJA21082 CJA21082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]