SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA23850 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23850
Domain Number 1 Region: 33-145
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000888
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  CJA23850
Domain Number - Region: 290-414
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000345
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 397-539
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000843
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 720-820
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0475
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23850   Protein: JA25230   Gene: WBGene00179422
Sequence length 882
Comment JA25230 WBGene00179422 status:Predicted
Sequence
MNTLIMEKEEAFRMREQLDHANESMSELRRKFNEFKRPKGFEEKLEKALTTLSNVEMGLD
DTTGIDGAECGGALMEVRALIRMLDGAQERLKDLVETREQLVNDKVLDEESARETLRSLQ
YAKTKSKELYERGATCVERLEDCVEIFERLKNESDEIERFLEQMEQRLDRYAASDRPEEE
AIVNELISEWNRNEAAMNNAAHLQRQLNERAVKVSDDVLSLKRLRADALKNRLNSWCRTI
QEMSEDDESALLEIDELHQTIEKSLNDVADKEPSKIAEKLRFLRADRDRLSSRTRKLAAK
NPHLAATSSDVLDSLNKKWSDLEQKSQQQQQNAPPPELEDAVLSSEDAPFDKRVGELYAL
LNNVGSQLDFDVSPVGSAVAYQKRVEDLDAYLDDYRPPLDDVIEEGRKIAQTGRLELQTH
AAIEQLDELANRIEEVETDLDRHRDKVAPLVEQQEQLKKDIDAFLLILDVFADRNLDDVD
IAKATRKELAERDAHIASLTSRATAIHCALPGKGPQLHDSTLDKLRDRIEKLEARLTKTE
KETGFAKKQASEPPIEEKSSPDRTSRSSLQLAMEAYGTATEDDSVISEAVTAVQKSTDDV
TAERVIILPDNTVKVIEDVQPPENIAEVSTSEILAARPAQEAIERTVREVPVDVYEETAN
ISSGDELQLISLADQLVDDADRYETDEVPSMDRKSAPVVLGELRKKVQSAEGPVIELVKK
LSQLVPRMQDDSPRSQDVRKRVYDIEDRFRKVSQAETFAVSTALSSALTEPELRKELAEV
QAWCEAAEKEAAQSVNSLDGDGLEKLDSRLAQFARQLQERNVLKMQKKTTTSARVCRKST
PSVLSVRSAANSRPSHSGGRGHVGDERVQKIERAEALGKGER
Download sequence
Identical sequences 281687.CJA23850 CJA23850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]