SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA27429 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27429
Domain Number 1 Region: 27-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.9e-20
Family GntR-like transcriptional regulators 0.017
Further Details:      
 
Domain Number 2 Region: 98-172
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000000212
Family GntR ligand-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27429   Protein: JA32775   Gene: WBGene00183001
Sequence length 176
Comment JA32775 WBGene00183001 status:Predicted
Sequence
MSDTSDVDISSHVFQDRLVISDDSQVKSLRDHVHDDLREAIISGRLKSGDRLNERQLAAD
LGISTSPLKEALRQLEGEGLVRTEARRGTFVSFNARQAEEMTLARAALESIIARQAAKHG
GEEAFAFLRAVIEEMRAAVESGDVDALIELNEKFHDAIHEASGCEYLRRLQNAQRX
Download sequence
Identical sequences CJA27429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]