SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|387817075|ref|YP_005677419.1| from Clostridium botulinum H04402 065

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387817075|ref|YP_005677419.1|
Domain Number 1 Region: 3-546
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.97e-191
Family Clostridium neurotoxins, catalytic domain 0.00000000000000127
Further Details:      
 
Domain Number 2 Region: 549-874
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 6.02e-122
Family Clostridium neurotoxins, "coiled-coil" domain 0.0000000000125
Further Details:      
 
Domain Number 3 Region: 1080-1295
Classification Level Classification E-value
Superfamily STI-like 1.07e-80
Family Clostridium neurotoxins, C-terminal domain 0.00000000182
Further Details:      
 
Domain Number 4 Region: 873-1079
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-52
Family Clostridium neurotoxins, the second last domain 0.00000000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387817075|ref|YP_005677419.1|
Sequence length 1296
Comment botulinum neurotoxin type A5 precursor [Clostridium botulinum H04402 065]
Sequence
MLFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN
PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTELGRMLLTSIVRGIPFWGG
STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHDVLNLTRNGY
GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPN
RVFKVNTNAYYEMSGLEVSFEELRTFGEHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA
KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKV
LNRKTYLNFDKAVFKINIVPEVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFT
GLFEFYKLLCVRGIITSKTKSLDEGYNKALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEE
ITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNG
KKYELDKYTMFHYLRAQEFEHGKSRIVLTNSVNEALLNPSSVYTFFSSDYVRKVNKATEA
AMFLGWVEQLVYDFTDETSEVSTTDKIADITIIIPYIGPALNIGNMLYKDDFVGALIFSG
AVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWGEVYKYIVTNWLAK
VNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEKNNINFNIGDLSSKLNDSINKA
MININKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDK
VNNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASEINI
GSKVNFDPIDKNQIQLFNLESSKIEIILKNAIVYNSMYENFSTSFWIKIPKYFSKINLNN
EYTIINCIENNSGWKVSLNYGEIIWTLQDNKQNIQRVVFKYSQMVAISDYINRWIFITIT
NNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDPHRYIWIKYFNLFDKELN
EKEIKDLYDNQSNSGILKDFWGNYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPR
GSIVTTNIYLNSSLYMGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQA
GVEKILSVLEIPDVGNLSQVVVMKSKNDQGIRNKCKMNLQDNNGNDIGFIGFHQFNNIDK
LVASNWYNRQIERSSRTFGCSWEFIPVDDGWGESPL
Download sequence
Identical sequences C1IPK2
gi|387817075|ref|YP_005677419.1| WP_014520039.1.18143 WP_014520039.1.57003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]