SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN20670 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN20670
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily PapD-like 2.09e-30
Family MSP-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN20670   Protein: CN09003   Gene: WBGene00159395
Sequence length 123
Comment CN09003 WBGene00159395 status:Predicted
Sequence
MAEKKQYISTEPADKVKFKADPQEEQKTYLKITNKSEMKQAFKVKCTRNDLFRIKPATGV
LDYNQTLTIMLIYRGGQEKLPSEERHHFGIYHIPAPEGCSCEGAWAEHYGPPQGEVKLRV
IWE
Download sequence
Identical sequences G0P1R8
CBN20670 135651.CBN20670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]