SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN01146 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN01146
Domain Number 1 Region: 162-298
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000488
Family Galectin (animal S-lectin) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN01146   Protein: CN04791   Gene: WBGene00139871
Sequence length 323
Comment CN04791 WBGene00139871 status:Predicted
Sequence
MHLVILFLFFFPSTVTRKPDTSENLKMIVINGNPVYSPGVVPGSRGDWTQCLEECRTTWN
CALVTQTATGCDFLLLNQVKSITPSDSGPKVAFKMNLVDQCPSGSPPLSGNPVSKVIESN
GIDFFETEVTSDSDSKLIFNYTVFKCLKDFPENPVLRGEYPIRVVYPLTSKFLPGEEFFM
KGKIRSTFNGSFSISFFSAANGNYPLFIKVINGWRSTPYTSSAWDNGIELSTWYNTTYRY
PVTIEGYPNPFNLSDAFEIRVNSSDTQVFVYLNGTTKLIFDLEPRFPLETTDQFIINDSG
YPHEKISDYYFGWTGECWWEPME
Download sequence
Identical sequences G0NAB8
CBN01146 135651.CBN01146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]