SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN06866 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN06866
Domain Number 1 Region: 90-202
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-27
Family Pleckstrin-homology domain (PH domain) 0.000000778
Further Details:      
 
Weak hits

Sequence:  CBN06866
Domain Number - Region: 37-79
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00442
Family DBL homology domain (DH-domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN06866   Protein: CN30900   Gene: WBGene00145591
Sequence length 223
Comment CN30900 WBGene00145591 status:Predicted
Sequence
MTFRNSVILEPDRNRGLSAKNDAGASSFIDHVKEIADRMVHYQNYFKEFVKYSARAHGSS
KSIQKALELVTTIPQRVHDLEFTNNLKQHPGDTGKLGRIIRHDAFQVWEGDEAPKLRYVF
LFRNKIMFTEQDASTSPPSYTHYSSIRLDKYNVRQHSTDEDTIVLQPQEPGLPSFRIKPK
DLETSEYVRKAWLKDIAEEQEKYGESFIPFYTRTRFSTNPFYP
Download sequence
Identical sequences G0NJP7
CBN06866 135651.CBN06866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]