SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN11408 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN11408
Domain Number 1 Region: 946-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000809
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 2 Region: 835-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.00087
Further Details:      
 
Domain Number 3 Region: 736-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 450-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 5 Region: 287-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family EGF-type module 0.044
Further Details:      
 
Domain Number 6 Region: 994-1042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 7 Region: 403-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 8 Region: 890-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 9 Region: 347-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000257
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 10 Region: 792-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 11 Region: 102-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000408
Family APC10-like 0.054
Further Details:      
 
Weak hits

Sequence:  CBN11408
Domain Number - Region: 697-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family Laminin-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN11408   Protein: CN14785   Gene: WBGene00150133
Sequence length 1633
Comment CN14785 WBGene00150133 locus:Cbn-lam-2 status:Predicted
Sequence
MTSIQWLFYLAVLWQVGHPQPAELYPSIDPNHFGADGNPCYDRQTRSPQRCVPDFVNAAF
NLDVQVTNTCGTKRPTTFCVQSGHTGQRSVCETCDNRHEGFSHPAKFLTDFNVGNNETWW
QSDTMMEGMQFPTSVNLTLTLGKSFDITYVRLKFISPRPESFTIYKKTTPDDDWTPWQYY
SGSCRATYGIPDRAPILPGNEAVAQCTKEFSDISPITGGNIAFSTLEGRPSAHAFEDSEV
LQNWVTASAIKIALNRMNTFGDEVFRDPQVLKSYYYAISDFAVGGRCKCNGHASECVGSS
SVDGENRLVCRCEHNTGGADCNECLPFYNDRPWRAGTANEANECIACNCSQLSNRCYFDQ
QLFEETGHGGHCIDCQGNTQGVHCEKCVANHWRRPGENFCVACGCNEIGSLSTQCDGEGK
CQCKPGVTGRFCDQCLDGFYDFSTNGCKNCGCEASGSLNNQPRCDSSTGSCTCKLNVEGR
QCDKCKPGYFDLSTENQFGCTPCFCFGHSSICSTADGYFAMNVSSVFDMDKQKWAGQNRI
GLQDTQWAELDKAVAVSDTDNSPVYFVAPEQFIGDQRSSYNQDLVFTLKVAKHVTNQDVK
DIIIVGADRQELSTSITSQGNPFPTTEPQTYRFRIHADPHFGWYPRINELDFIGILSNIT
AIKIRGTYSYKDIGYLSNVNLGTAGVAPSAANPKQATWIEHCECLPGFVGQFCESCESGF
RRETKYGGPFNRCIKCDCHNHSNSCEAESGSCICEHNTAGDTCERCARGYYGDALQGTEE
DCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDNIDCNECACNGN
TDPNSIGNCDKVTGECKKCVFNTHGFNCEKCKPGYWGDALIEPKGNCQSCGCFAAGTRRP
NNDYTLLECNQEDGQCDCLPNVIGIQCDQCAHGYYNITSGLGCQECNCDPLGSEANTCDV
VTGQCQCKPGVTGKRCDQCAPYHFGFSANGCQPCDCEYIGSESQQCDVNSGQCLCKENVE
GRRCDQCAENRYGITQGCLPCDDCYTLIQSRVNVFREKVKSLDNTLQEIIENPAPVNDTK
FDEKVKETSRAATEVWEAVKQKTKEGGGTIMTKSKAIKEEIVLALEKLTTIDESVSQARL
GADAAENDMRRWEIIIENARREIENVLHYLETEGEERAEIAFKASQKYGEQSKRMSELAQ
GTREESEKHQKQATDIEQLSEQAIANATQANKEASDAIYGGEQISKQIAELKEKQNQINE
SITRTLDLAEEQKKTADEANQLAAVSLTNVEAVKIPSVDPKELKNDVAGVLEEAENLIDS
SVKENAANDELFEEVDRVVADARNELQSSQDQQRISDQLMLELEKARERIVESVSNADKT
LKDAEAALATLEEFSAKIEKSRNDAVAEFSGVDGINGKLADILKKQEEKRNSLPLDKQFT
IDYRKSADRLFNETQDLAERYKELINNDTDTRDSAQVVQDDIEQLIEELTESKENLQYYQ
KQAEDDKQMATEAVRKATLAKNSAIEANSTILTEEEEIKKIIDALNTMEEVNNAELDELE
EEIDKLDQMLAQAQLAKEVPTFQQFRADEDAKVAQLKNDISDLQKEVLNLEEIRDNLPTK
CFNVINLEQEGQK
Download sequence
Identical sequences G0N538
CBN11408 135651.CBN11408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]