SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN13678 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN13678
Domain Number 1 Region: 11-44,116-182
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-24
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 388-532
Classification Level Classification E-value
Superfamily Fibronectin type III 7.19e-22
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 3 Region: 224-307
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.46e-18
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN13678   Protein: CN27511   Gene: WBGene00152403
Sequence length 629
Comment CN27511 WBGene00152403 status:Predicted
Sequence
MSCFQVDNDKMARFLSLHVLLIGSVVLYIILGAVVFQMLEGEHLDALKKDHMDRIDSNAT
DYVNKLWELAKRDKNKFKNVDELITSIKKETSEDFNSYVDTVFYAHRAVRHGYDEDSPTW
DFANSVFFTTTMLTSIGYGYVAPSTFGGRLFGVIYCLIGIPLTLVTVANVAKFLSETIFF
LHYELWNKCLEWKRKRKGEVEADPAQPMFGDDENEEEILDRVRLVRFPPLTVFLFVFVYG
CIAAWVVRYWETWTYVESLYFIFISILTVGFGDIRPSPGNIWVTLAFVVVGVILTTMCMD
VVGRMYLKEIHYLGRKLKSNNPFYLLREAKARRRRAAMASLLAQLAKGMIFAHKDYNELA
RKKSKRKKEKRRGSHVLPNEKFMFARLPPDPPSDCQVVSTSAYSVRLAWAPPFSPDPDLT
YNIRYRLKHNEDAKVRELRGIKGNTVEIMSVDSCSLYEFRITAHNKFGESKAVYLVQYTE
PQLSPQHILATRLNANTIELTWEPPYKKSHEVKNYVVYFTENPNASLSEWEKIPVNGRRI
FVSIGSTCSGKLTVFDTESKIIFFSATAVFKDGQRSPLSRALFIKTDKIEFHKHCVGHSK
TIDVMDSICEKEENETTALLKRDYVSFAV
Download sequence
Identical sequences G0NUW2
CBN13678 135651.CBN13678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]