SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN17314 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN17314
Domain Number 1 Region: 469-591
Classification Level Classification E-value
Superfamily PH domain-like 6.89e-17
Family Ran-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN17314   Protein: CN04606   Gene: WBGene00156039
Sequence length 593
Comment CN04606 WBGene00156039 locus:Cbn-npp-16 status:Partially_confirmed
Sequence
MSSDTASLPPTSEQQMNIFRLRDKMSLLNSEFLKVIQSYYEEKNSYDFSTTMLSYLDHVK
KLKELYHVGDGVVVPKTVTPAVPEPARKNVVAAPEKSVNVAQRKIAKATRRNGASQSSDS
PKIANSTVFAASSPASVASAPKFGDISVIAKETPAPLSKTGPSVESSAPAAARKRAIRGG
GPLGGSESVIFKSGNNEPQASTSTVQIPETNIKFPEPSKDFWTKKDSNSGTAPSNAGSLF
AFLGKDNDKAKEPSKFTGFSFGKKADTESEAGSKTESTGKPMFGSQATTEECPKKSMFGA
SNGADESPKKTLFGTQKSADDASKTSMFGAQKTSDDAPKVLFGQKTTTADVPKTSLFGAQ
KTSDASQKSSVPLFGTSNTNEATSPPKLTFGQPKEKSDDASSSAPKPFSALSFGASLFGS
SAGKPATTTAPTLTFGSGTSTSSGSVFGGFAGLAQKAMDNQSKPEGGDEEDAEYVPPKVE
TVEAEEPDSVLSSKVAVFKFSGKEYTKLGVGMLHVKNSDGKFSVLIRAATATGAVWLNAL
CNKTMKATIVDEKGDRIRLTCPTSMTEMTTMMIRFGTAEGAKKFTDKIAEVAN
Download sequence
Identical sequences G0NRG0
135651.CBN17314 CBN17314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]