SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN21268 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN21268
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily PapD-like 2.2e-22
Family MSP-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN21268   Protein: CN20065   Gene: WBGene00159993
Sequence length 115
Comment CN20065 WBGene00159993 status:Confirmed
Sequence
MGVEVSLDPPVCPIQANGGTSKHKMINHTDRHLAYKVKSSNNSNYSVNLIYGILKVCDVK
ELIITRKPGKPQADKLIIQYCQVNDENADPKPLFANGVPPGELSGETIIKLSAAE
Download sequence
Identical sequences A0A2G5UUF1 G0N3Q0
CBN13312 CBN21268 135651.CBN13312 135651.CBN21268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]