SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN21448 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN21448
Domain Number 1 Region: 868-988
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000575
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN21448   Protein: CN17441   Gene: WBGene00160173
Sequence length 993
Comment CN17441 WBGene00160173 status:Predicted
Sequence
MYKRETTGYSHPPTLKSPPPLPSPMDSNRSYRWTSMTAANSSKFSTTPVKETPKKPDTSW
WSPSRGDTWRLNAPRGRTLNLVAAFDQCARQENLESPKYVTVNRFRRNSEPMQENEEKEI
VNTNFIDDSMIDDHEEYEEHDIELDMDYYDPPTVKHHRSVEKFDGGRKVDSVRGNRLPSE
LQNHSSSYTHRATVEHVISDDGDSKMPISTVAGFITSTPQVVRGYPDDASKYFGQEGSIR
GSPRNRRERRQTQTISLPSFDSPASERKLKHSATNSPTIPPKMQIRSPSSLVKSIATEFE
KADFGFHRKIDAAQEIADLKKENEADTFDENQNVVLESAEEEYSHESVPRISHLEMRPSI
QMGVSGYKLKNRDRVLKESEEKEKEVLYSLPFKKVHNKLEKVGSDQTDEKMLTPRGKSVR
QSLPFSDIPEERTCDKIDEMFDFVEVPTGEFDDKTTLERTIDEYAEIRSEDSPTKKLIDP
PNMSTSTYQEIEFDKDTTPYVEQVDDDGTGFSVSSSVPQFTRSPTLVTPHAGQSVTEYRV
SEKEGCARTEKVIVQKMMQPSALATSTPKGTFAWRNRNQSNAPEDSFVSSISNFSAADKM
NDSRRQISKLIETIEKTRKHIQLAEISLIDAKRARMVVQELASQRVLLICRERLKLQLDE
VRRLQALSVVRHPPPPINRHFKSAMVISNIAIHLNKNFNCRMCPYRSDLQTFFATGGSFA
FIVALKCRTEIEATGVVTLLAHYQTRMHVIHFGEHMHFSNLPVDFVISMEVYMMRVPEYK
APEKTCASVLAAKFRSLLVPSSAHRRSKNNTISANRTVLSMPGYQAPECEFKFCGKLTLD
RDSAGDRQFYLDDVTYPLEGTVKLQSHCSSLPEAIDVEYRGFLYLFDERSPNGDAAWERY
WAMLHRGVIFFWKNPIDEKNEKVPLSQIDLTKCTNQSIEETRNERAHEFHIELLIDQTPS
LLEKRRVVLAAESADHLSSWLNAINDTLYVLRS
Download sequence
Identical sequences G0PE52
135651.CBN21448 CBN21448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]