SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN21496 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN21496
Domain Number 1 Region: 644-773
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000466
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN21496   Protein: CN15142   Gene: WBGene00160221
Sequence length 777
Comment CN15142 WBGene00160221 locus:Cbn-ani-3 status:Partially_confirmed
Sequence
MDDSDAPEIKSMPPTPLPLGSSRCYRWTSNTAAQNSLFSDSPAVIEKPPLDATWRKPVPR
GRIRDLVAAFDQCARFEQSTDFKNSVNDENKPLITVKREPENRPSGDQFKTPQTSTPKRP
SSTEKRHMRTGLDLNKLEKPADETPQRLSPLTQRHQGRRGTQAVVFKSSPLAQSAPESLF
PANVRKLTQKMEMEMRRESSYRMINETHVSISDLRREQLYMMEEKENAAPHYPLEYSKSE
EDLENEKLFYEDTKDFAQMSIHNNTDEAMGDEYEEEKTLDRTFTGGESEDVILEAAEKVS
ESSPKFTSSPTLFTPYAGQPVTEYRITENEGAHKVVKQLQPPAALATSTPFGTINRKGTP
SSSADFQNSFVSSISNFSAVDHANDSRRQISRLIDSIDKTRHHIQLAELALIEAKNSRIV
VQELASQRVLLICRERLKLQLEEIRRLQALSVVRHPPPPINRHFKSTMVISNIALQLNKS
FQSRGSFAFIVVLKCRSEVEATGVVTLLAHFQTRLNQIQFAEHLHFSNLPVDFVIGMEVY
MMRVPEYKPPERTCAAFLAEKVRNIFVPSHAVSRRPITTTTHQNHQLLLNKTTTSLPGNY
SAPECDFKFCGRLTLDRDSAGDRHFYLDDAIYPLEGTVKLNSHCSSLPEAIDVEYRGYLY
LFHDPTTPAVRVNEAPSWHRYWAMLHRGIIFFWSNPIDEKQEKTPLSQIDLTKCTNQSIE
ESHEKSNNADHEFHIELLIDQDPCRLEKRRVTLAAESSDHLSSWLNAINDTLYVLRS
Download sequence
Identical sequences G0N0V3
135651.CBN21496 CBN21496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]