SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN22298 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN22298
Domain Number 1 Region: 327-661
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.71e-92
Family PDEase 0.0000125
Further Details:      
 
Domain Number 2 Region: 155-310
Classification Level Classification E-value
Superfamily GAF domain-like 9.25e-27
Family GAF domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN22298   Protein: CN17348   Gene: WBGene00161023
Sequence length 805
Comment CN17348 WBGene00161023 locus:Cbn-pde-2 status:Predicted
Sequence
MIQLRRNSSPTANITTQQQQYPSNSTTTTFFTGANATKTPNETSASPTVWRKTSHPPLHF
NNNETRNRNLQMQLKNRGTKDDWGASLRYDIEEPTSSGLSDLPPDVPIVRKLSRPLVKMD
DLDDTCSVSSTGSDRTILSPLVPMSIFDKFLCLTSNLSGLVSTIIAESRKTTDCEDYAVF
FYDDDRKHMVLFNNETMLMTGRRYDLGIGIVGRVGDTMRTMNIRDVSRCPFFNPEIDEQF
GVKARNMLAFPLIDSSLSLIGVILLYNKADGFSRNDEKFIKRFSYFVANAIAHAILAKQI
DEVRTRIHMVEEFKVQGEDVVIQEVDIMRLVNDPLRDWRYFSQNFADWSFPPRSVGENHF
HKASMMFFEDLGFSMQYKINKRKLSFLVLRVSVGYRTVPYHNWSHAFAVTHFCWLTLRTD
AIQRALNDMERLSLLIACLCHDIDHRGTTNSFQMQALQKTPLSVLYSTEGSVLERHHFAQ
TIKLLQQEECSILENLPAADFRTIVNTIREVILATDISAHLKKQERIKSMVVEGYNPMSF
DHRYLLMCLVMTASDLSDQAKNFHNAKKIAENIYLEFFSQGDLELQLGVKPLEMMDRTNA
YVPTVQIDFLYKIGVPVFQMLATIVPEGKTTAEAIEANQMCWIVLDEECRNNPNATNELE
YLRDDDLERRIYDKVRKQDPRAAEIASKRFEPVYANGTVLQTHDILDHRFDGYDKKYQFW
NSPNNATTGKQQQIRSLQKLKSKTSEDVALLKPDNGSAGSSRRGSRTPRRLWRRARALIS
SMSSSCASCSPLPSRRQVSDDSESG
Download sequence
Identical sequences G0NB39
CBN22298 135651.CBN22298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]