SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN23287 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN23287
Domain Number 1 Region: 1616-1745
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000931
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN23287   Protein: CN17463   Gene: WBGene00162012
Sequence length 1748
Comment CN17463 WBGene00162012 status:Partially_confirmed
Sequence
MGRKKNKNRQNRPSLASPSSAPCFQDLGSPNLFEVKDTNLGEEVEIPSSFSVKEPANDVY
KTVYLSGDEVNVPLNSSTSRQATSEKNGSRGSNSSSYHDLIDGGAYNQFRTSRQSLNRSK
MDFESAGDRVMAGSRSISHRSLFTDDRSFGRSGNDTRPKTSSSFAGSHVSIEWDNDMGTD
ENDNGKVRISRGRERQNSHLEPMGSYEETTRKPFTRSRTVSSGGSNRVISSSHKNNNNLL
QPFSSSQHAIDPLSEDVRTFHAGSEYLQNRLSKLSIHSNNDEFVLVGGHPPPAMSASVES
LNQEVPIPRARSRLSSYSEKMYEKTPSVTLSQEDLLGRSISQQSLNGSNDDKHRNDGHVS
RSSSRYTVGTSSNTDDRLILAARYSQSPEAEGLLSHHQEHHSSRPSSRRSSASRSHSNEH
VGFVEIPTLYSHPDERFDDNDESGEPFRPTSEHSFTPTATSRVRPSLVRSDAVTNNEGGG
FSSSSSSLSRHDSNQPPRALLVTSALTPVVPKRHAPMSLSHSEESLVMKTPQTVQRATDH
HQKSLRQNAESVKKTVEMAVQTGNSIRLRQNQPLGDVLSECAYLPEPKGIGLTSTTTTSF
VPHAQPPKSVPSADPTFVEIPKNSIRARLRHISDIYSNDGVGSEPTPTYSEVPNTWVEIP
KNTEKPPVYNYLKKQPTHKSSEEIFVPKPSKYAAPHQFVEIPRNVEVKRHVEIAKPKSME
KIVVPITKTSSIVEIPNNIEKSGDTIRKHIPRGRIRDLASAFDKMTGGSPARPLEFKSQV
HLPRSDDGSQFWANSLKKAEAESNSDIRVGSPLSGRLSGPLNGSSSSAFRSSTQTIRSQE
DRRRSTSSSLHHQPHVFTRNTFLTSSVVKPGDKSNLPSNVAMSTSYSRQQDNQAKGDGFV
SAFEKASSTHLHSNDENDSRRNSRTFISNKNSPSKDATFSEYTRKVVEVPISGVSMPQKL
RRLANGHPRAKTQEIPSGTFEFESRYESRAVSGDLNESNVFGMQKPLFAASREAFGRDTA
EDLRAKQENWPQVRQHQWTSEFQMSESKNTNSMTQSPMYHHRDFEEIHNLPTPTQYKTHT
LESPITRKPSLPQSSILNKQSINTMMSRNPYSPPATEDAGSRITHHTSQTLQSEDLFATE
DSSIRGKIDRMFDFVESDDSRKTMTPNHESHASTETIGTNGINMQKYQTTNNRPNWNETS
SRLIGGINKAAEIPQALKQRQEPKLKSPERRNTVTVPELEYFDNELEYSLSQYREMQREQ
LRRRLPSADEPQFFRSPTLTAPHAGQSLHAYRSKDLLGTPTAGEKFRFPSSSSGLKLPTA
LATSTPVESPSGRQSSFSINKNYSHLEMIPNNSTNPPNETFVSSISGVSHADKHADVMKK
INRLSYMIENTQKQMTMNEAALLDAVKKGRRSQEIAAHRSILISRETLRLQRNELRRLHA
FSAVRRPPPPVAKELRGSVVFKNLIVHLNKLFVQRLAVKDDNSYSFVGLFKFGHQVEATE
LVPLRVFPGEETCDKLFFVKQIQFSDVPVDFMVSIEIYAMRIPSAKPAELSIGSSLANKC
KSLMGPPQKKSAIPVETAFKFRGRLVLDRDAQGERCLYLDDVTYPLEGTVMITTQCSRLP
ESFEIDFRGFLTMFHTISNMASWERYWAVLRRGVVLFWKYPDDEQMGREPKMQIDLTKCT
NNSIEKCGFDLCPRANSFVIEILVDAEDGTIGSVVEKKRVLLSADTSEMLAQWLFTLNQT
LDVIRGPI
Download sequence
Identical sequences G0MGM5
135651.CBN23287 CBN23287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]