SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN28220 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN28220
Domain Number 1 Region: 197-291
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-27
Family SSRP1-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN28220   Protein: CN36989   Gene: WBGene00190185
Sequence length 292
Comment CN36989 WBGene00190185 status:Partially_confirmed
Sequence
MTNLEITGVFIENVGVLTPGTFKFDIDSFSFKGDRGKKSVKVQTHDIDEVRFQKLGNKPG
IRFALLDGGAHRFGGFKDTDLENIKEFVKTHWQMEIHNTELFIKGWNYGQANVKGKNIEF
AWENTPIFEIPCTNVSQCVANKNEAVLEFHQNENSQVSLMEMRFHMPVDPDDEDEIDKVE
EFKKAVLAYAGLEAETEQPITLLSDILCTTPRGRYEIKVYPTSIALHGKTYDYKIPVKTI
NRLFLVPHKDGRHVYFVLSLNPPIRQGQTRYSYLVFEFLKEDEQDLELAITE
Download sequence
Identical sequences G0PNS9
CBN28220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]