SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN31493 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN31493
Domain Number 1 Region: 1012-1138
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000249
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN31493   Protein: CN33824   Gene: WBGene00193458
Sequence length 1145
Comment CN33824 WBGene00193458 status:Partially_confirmed
Sequence
MDNQFDSIMERIRTRQNEMSGSEEAKENEKAPQTSVTKQGESSATKVFGTSSKVNDPSKD
TAGVYFRPAEPKETTPKSSTSSQEPENKTSTAKKPSRFSILAQEQEEFESDYTNPYNRPK
EAFMKGRSPRMSIGEIRPAVLCTPAGAASIKSPNVAKSSEVSKNGPEIALGMSDFEARRI
KFAQPIVNVNYLPNESSIFSGGSSSANDMSTVLGGSAEMMNVTTSSLSCGETSLMQHVTN
ENTLINAQSCDNREAILRDRVHMENASIDEYGAHTFMRKKVPKKAPEPSTIAPSNVFTKP
TNIHTLVSSPKPYSKDVGRAIFSPVHFTPKSTSSPKTIQTTTTTTDTIMSPSKIAALEGS
VATTRRMQFEQQLKKNNTNLVSSVPAAPIPTPRHVLAPSAIQSTPHHPYTAQQKKNLFPP
SASKTATTTTMKTTLAAKPLVATAPIPVQTQWRGQSNTPVVQGARAEDKTAGDQLVGAGV
GKLKNLKSRWEFCSATGTPIHPDATEDSLIATAMKMKESAIPKQIGHRSAYGRKGPSASS
LHSQQSDVRSTTASPASKNIRYGQEEYEDEEDDNVFEEESRPQSAEHDEISVMDDIETDT
SRFIDNAFGFMEGPGTGTPSPFREAPLAKEELLFRKRTEVIEEEDIQDNSSEEDNRGDEI
GKAPEVVPEETPIYNNKKANDSGLAYSVSFYRKFQRERVGENATLTPLASLSPSAPVASL
TSPQKLKQLTSSYDGPAGGRIMESEQETMRRIHEASKIEEEQISQSQRALARARDQPSFR
GSREEFEAQRALLVHVEKHRAMNVELCRLKKEGARIVDGPRGTLSIMQLSVQLDREFVKN
YIEAPVKPEEVFYFVAILRYADQVDVSKMVTSDNGVNRRGTLDFPTPMKLTAIPPDFRAT
LEIYGQRSVRESTTHEDKFKLKSTTLKAKVRPGFLGGSTSSGNQSLFGSSSNKDKEASSI
HYYDPNATRFNLLASISFDINCRGKTTYNLPNLVYPLAAELQMKVKKEAVDGADIVFRGF
LSMYQRTNEGLGSWTRYWCVLENGEMKFWRQPEDEGHKSYLVLMDLSTCCKQEGASTVND
ICPFPNSFHIDVWAPKDDPNEPRGGGIMQLRVMLAADTAQDLQKWLSVINSTSRQLCTWR
NPIQL
Download sequence
Identical sequences G0N600
CBN31493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]