SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBN32224 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN32224
Domain Number 1 Region: 159-215
Classification Level Classification E-value
Superfamily PH domain-like 0.0000139
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN32224   Protein: CN34872   Gene: WBGene00194189
Sequence length 218
Comment CN34872 WBGene00194189 status:Predicted
Sequence
MYSRLKSSLLNHFQRGGGNNGTNNPSNSPNYNGLSKEERKRLRHSLAECQLHDIYENNDS
AHLHHHHHLLHQQPTSYQHSVSSVTPAGRHHHSTINHAPLAPQEEYLDESTSSSNSTFYS
DLLGSSFSSSGNSSGGFTCDYEDTPNDYSFIMASGLPSLSWNVQYIGSFPISGSYVDNLG
KRIDSFQPSGGSAIQNVELSISVLGVKISCEKKEKGIM
Download sequence
Identical sequences G0MPW6
CBN32224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]