SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA00024 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA00024
Domain Number 1 Region: 109-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.76e-23
Family Nucleotide and nucleoside kinases 0.00011
Further Details:      
 
Domain Number 2 Region: 2-98
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-16
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA00024   Protein: PP17867   Gene: WBGene00089578
Sequence length 188
Comment PP17867 WBGene00089578 locus:Ppa-lin-2 status:Predicted
Sequence
MGVPFKTGDILQIISKDDHNWWQARFVTQFPSLGQQQYQGPVVAGLIPSPELQEWRTACL
AMERAKDQSHCMWFNKKKKYYTTKYLQKHSALFDQLDLVTYEEVMRLSQYRRKTLVLLGA
HGVGRRHIKNTLIHRHPSRFAYPIPHTTRPARKDEVDGKHYFFVSNDHMLTDIQNNEYLE
YGTHEESM
Download sequence
Identical sequences H3DRJ3
PPA00024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]