SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA00242 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA00242
Domain Number 1 Region: 80-270
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-29
Family DBL homology domain (DH-domain) 0.0000353
Further Details:      
 
Domain Number 2 Region: 12-69
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-18
Family SH3-domain 0.00044
Further Details:      
 
Domain Number 3 Region: 289-378
Classification Level Classification E-value
Superfamily PH domain-like 0.00000902
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA00242   Protein: PP03718   Gene: WBGene00089796
Sequence length 625
Comment PP03718 WBGene00089796 locus:Ppa-pix-1 status:Predicted
Sequence
MDHGITTPDRKSFYARSQHAFCGKNNDELSFGIGDVIAITQQVEGGWWEGTLNGETGWFP
SGYVTMIADKVNGFNASDGNSTQKQFISQVLESFLKSEGEYILSLKNIIENYLAPLSRSN
VVSQGEFNTIEGEISAIFALQANILVLITDMQSTDLSLQRIGGVLISSAPELKQRLTDYC
ANHPDAVDVIKHRRDELDGFFTSLDGNMRTFIQGLSEPFRHLKMYPPVLQELHRMMPESH
ADRGDLQRSVVVYRDLMELCEWVRRQREVQTDFLRTPRVSQFVRDEAPGQIFIVGGASVS
REEEAEDRTVSLFSDYVVIFEMTPNGEDYILKDMIPVSNLSTRRMTARNAIVMKGIDEVT
FEFPSSYDCDRWVDAMRKGKVPFEEEINGKASTPIPAGPPVAVTMRSRKKSMDESLDQMD
AALAADSLQFARLRNKNSSHQMASTPTSSTSSTSLRKPKTPLDDTLPFRINHELEMIMPE
GLDDDEREDGRGGGRRNESAFYMRHYPPFRSPSNMVDLGKRGVKMRKDPSSARDHGDATL
LAIVEGYLNVGGEDNDRGGGSLKRADQPQLIVAEDEKLLIEETVDGQTVMTEKSLVDVVY
ALKDQMDRMVEIQCTVDLKSSDRQL
Download sequence
Identical sequences H3DS61
PPA00242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]