SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA01095 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA01095
Domain Number - Region: 211-277
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00777
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA01095   Protein: PP23314   Gene: WBGene00090649
Sequence length 971
Comment PP23314 WBGene00090649 status:Predicted
Sequence
MLKNADDLNSAIEYATLTKKSDMKIPCVRLLAVDSVPTVDESECAPEEAMAELAADHSVS
GMLGETLTRLEAAVAESSVLLQDGLADPTSYAGQAGKLKTTIFEVQLVVAASLPSDGPVV
DALATSAAQAERVVAQLESRANAWNEFTTARDAANKQFDELCLRLIELWTANKQRLQQKV
VVTREDVTAAYGLLDDLSRHQDTISVMKKFAQELEPLELLFQEIRSLEDSIPQMARNGQD
LMNDLWKQDLEVQARSEALWIKYDSLRSAAEEQLHMLCDILDEMNLDYALRKQEKRRATD
ADLTTAISEAQKILYSLRETRAGLQELGDQLVALGKHCSWGSGYIDCWIDKTIGNAEWLV
DELYNEQDCIDHATTEGNDEINANRTFGDHVYLLDPQDPGKWIVLSTDADITKLWPKSDN
PVRCEDVGTPDAPDHPLDQHEAWTEYLTLKQDAQFHFQWVQQTLVKLGNEMMVRKRDGIP
ATEADLELAKGVHEDALAMMESLSKLRQERERLDLPYTRACWEDRCFKYTLKQAAANAEW
LVTKLSAETKARAEAVRQDVEARLYHLEVRLAELGLDRVMRQEDGTPVSAADYDAAVHVL
QDLHVLMGKRNLGDDHASLVAEIENAIDDAQWLLDRVREEMHKVDPADKDKCPSNHPGFL
ETASSTADEMEHLKCRIAAWTPFVDAFDSVDSQFQRLQAKLEELGLSMALRRQSPRPEYL
FAAAINQDENTTLAVQRATYGLETEIHLLRRLSDALDRRDRPFSSINNFAAKFRLVCDNT
AWLIKSLKEERRTTARALFEAARQATEALMYQCQERVSELGFEHSLRKQENCVSTESDLR
TAVQALECIDLLRNDNHERYSQLVHTIHHIETSYIPNFDAELQQMKDNAEWLVAELRAEI
GGSDRHDKKQEKYIKCSNKKALEKRKFNLGKNKLERKSRSTEKRLAAFAVRLEKVEEKMK
MMKAMPSNMEC
Download sequence
Identical sequences H3DUL4
PPA01095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]