SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA01578 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA01578
Domain Number 1 Region: 14-116
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-25
Family G proteins 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA01578   Protein: PP10800   Gene: WBGene00091132
Sequence length 129
Comment PP10800 WBGene00091132 locus:Ppa-rho-1 status:Partially_confirmed
Sequence
MERRKERDRLRNDKLVIVGDGACGKTCLLIVFSKDQFPDVRHFCPNVPIILVGNKKDLRN
DPQTIRELQKMKQEPVKPEQGRAIAEQIGAFAYLECSAKNKDGIREVFEKATQAALQQKK
KKKSKCTIL
Download sequence
Identical sequences H3DVZ1
PPA01578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]