SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA02011 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA02011
Domain Number - Region: 116-216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0101
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA02011   Protein: PP07366   Gene: WBGene00091565
Sequence length 265
Comment PP07366 WBGene00091565 status:Predicted
Sequence
MIDDKSFYSSNDHAPQQLADSQNEKPVPVSEERYRKGDKKKACPFGLELRNRKKRFPAFK
KERLSSGSAKPKTAERPPSAVSTASTVAAAAAAPAAVAAAPTLSKAEAMLAKDKLDASEL
KDVLNEIEAYEGTMDPNALKITPDGLDIINDKKYYFRSRLAELHNVQRLLEQRKEEALFR
EQYSQAGGIDKCLQQLRLREEPLKELLIERMDALKKADYDEAQVQKDRFEINLEAALDIP
DLKKFISAKEMTRIRKDAKDRPNKD
Download sequence
Identical sequences H3DX69
PPA02011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]