SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA02176 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA02176
Domain Number - Region: 2-41
Classification Level Classification E-value
Superfamily SH3-domain 0.022
Family SH3-domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA02176   Protein: PP11641   Gene: WBGene00091730
Sequence length 68
Comment PP11641 WBGene00091730 status:Predicted
Sequence
MQIVENGDPDWLHGFKLDDRTEKLYSFPATCVALMRNGEQPMKIVQNVFVADQKLRLYRD
QIISFHSS
Download sequence
Identical sequences H3DXN1
PPA02176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]