SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA02402 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA02402
Domain Number 1 Region: 40-111
Classification Level Classification E-value
Superfamily PH domain-like 0.000012
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Weak hits

Sequence:  PPA02402
Domain Number - Region: 364-461
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000245
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 686-727
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0459
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA02402   Protein: PP03833   Gene: WBGene00091956
Sequence length 789
Comment PP03833 WBGene00091956 status:Predicted
Sequence
MEEDNAGDIFKSLSGGKVDVETEAFVKLCDRSFNARLRVRGNILCVQAISEAVEPLIFIL
VKHQVLKAEDNHPDFPHGFVIQFKNETLTVYLKDKEERERWMVKVATASHDMAQAELDEI
AHRLFAASTAENGVDHKEEKTAEGKPGSSSFEDFFLTNPCTIQHKFSITQKAGVPARLIT
YSETIAESKLSIALPVEFVKLYKQWTTEMIQQIESFERRCPAQDESSRQELCRLLRENSE
TLEQTWEFLSTYSGPSFRKSIEKRRVAFAPVPTNLHYQRFGPIGGEERHVLTAGVAAALP
LRFQSGGLPKLRSSLSLHPAYTDAIFSAKRSELFEIKKMIGALSYKLENEWPNDKECDRL
DKLCVDLQAGVKQVYARLRDVETGLAGVERHVDSLMDIGHAPDTLRNQLDNMDAMLVSLQ
TKIAVIDSLMESPSELSSFSLNTRESMIGVLDALLSLCTSLIDAQQLGRLRSLARSADTA
VYVHIILRADFVFSQASTIAATAVMSRLQRGWPMNGDKAADLLLLVWSWISLYGDERGMI
EDATEAWRSISSRLLIRLVRCPSSVSRTVTPLVAGSRHCVIVSLPLPQDFFDALPPALRD
PAHYIRVCTSFWSLGVNHEATIGYQFGGVAAETAINQTALSDLQSYASSRSPLSAAAQEA
LAELQVVVRADPSRKNMLLYEWAMAAGTELDGELVVSCKSGKDRTAMGVTLEQGRLMRQA
SGLNATQAAEVVDALRKNGARREVCRKNIDKAAYSFSAFQMHFLPKSFRPPSGTFAHVVN
CSERVAYGL
Download sequence
Identical sequences H3DYA4
PPA02402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]