SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA02552 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA02552
Domain Number 1 Region: 121-323
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000354
Family Extended AAA-ATPase domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily DEATH domain 0.00000001
Family Caspase recruitment domain, CARD 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA02552   Protein: PP00714   Gene: WBGene00092106
Sequence length 435
Comment PP00714 WBGene00092106 locus:Ppa-ced-4 status:Partially_confirmed
Sequence
MLGEAENRVLRRLFIDYGEDIDTKGLVTFLEIKGVITEEKADSISCNDKLSNREKQNHLI
RTLIRQSSEGLQPLVKFFEQNSVNQRHISEWLSGQINEIQNGGNGRKEETILSEMKESRV
PSVKKEVKREEMVAKVKEALSSFNNDDAFFVVLHGLPVIWMMDHHENSKDLTRFMSDLYV
YLMDSTELSGKESPPIDKASIIHLTKLVGESLIDHPNTLIVVDGVMTRETVSWMDHLNVR
VLATTRNALLFEDVSQPMKMIKVDGLEELEVAEILKGGREEEVDRETVKKVRELSEGLPH
VVKQLHKLAAGKKKELNYYISRIDRSGILSLPNANSYDKETLSATLENHYSMMLPELKEP
LNSLVVFPPTVFVPIEILSAVVPVDVVDNEDVIHELSIVMERLAKLGWVEVKEEETEKER
GEVYRVPRIELMRTG
Download sequence
Identical sequences H3DYQ4
PPA02552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]