SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA02561 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA02561
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-20
Family SH3-domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA02561   Protein: PP23787   Gene: WBGene00092115
Sequence length 111
Comment PP23787 WBGene00092115 status:Partially_confirmed
Sequence
MLKSSPPSNKAEPVSPPEPQRVVSPASQSVSLGGRTVTGAGQAGFAVKAIYDYTAADKDE
ISFIEGDIIVNCAKVDDGWMTGTVQRTLQWGMLPANYVEPYKQPTGLHRIH
Download sequence
Identical sequences H3DYR3
PPA02561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]