SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA03302 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA03302
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000731
Family Ankyrin repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 185-268
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000377
Family DEATH domain, DD 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA03302   Protein: PP15297   Gene: WBGene00092856
Sequence length 272
Comment PP15297 WBGene00092856 locus:Ppa-ikb-1 status:Predicted
Sequence
MKKEIRAQITLTDRFDNSILHYLAESHNDDIYKEVLERSLDISHFEAKNNEGLNPLHLAK
GADANVEDEPGMNALLLSNKVGNYVIMGQLLDAGADAYKETKNGEKLADSDDEMVVKIIG
GERTAQVFKVVENDGIEQRRGELFGHSSHGGPLVEELDELDDEPGPSTSRERGRRTGLSL
GNDDVSCLDYLTRLRLSKVLDLQSKWEVLARELECEHMIELISICSHDSSPTMILLDQFE
QLPEASITRVRGALERIGLEEGVKLIDERMVY
Download sequence
Identical sequences H3E0U1
PPA03302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]