SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA04163 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA04163
Domain Number 1 Region: 239-337
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000394
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 534-663
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000015
Family Nucleotide and nucleoside kinases 0.0016
Further Details:      
 
Domain Number 3 Region: 427-503
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000144
Family SH3-domain 0.0078
Further Details:      
 
Domain Number 4 Region: 342-404
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000131
Family PDZ domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA04163   Protein: PP25935   Gene: WBGene00093717
Sequence length 723
Comment PP25935 WBGene00093717 status:Predicted
Sequence
MRKDAAHGTATLSFLNGAQRNPSVVGLNGSSSVGKHKTLFSKLFRRNGPTSVPSPSSPIT
ERSNVVARANIDDRRNGGDYFVRHGSLRLPSSSVPQHFSRAGSLRAPQGSVDHKKIIDSL
DRYLQGHTNNRASPLTTSAEIGSTWPKSVDGSTESSVLRRRSGQRPSVFPVFAAPPPPPL
ETASDRHCSCSSPSPWGDDPNRRDYSPVPSSVASHRMSTYSPSLPLPPPYPGPRYGDESM
STPSESEAEVRRVCLRKEQSNFPPEFGVGLEDGSEGGVYVAHVHERAATHGVNKGDRVLD
IGGINMRSADKSAAARVLSQFHASQDEVTLTVSTRGSVPSAPFWVTVPRGKVRLCGGNAV
GILADTSVGDLMAGDCILELDGFDLRKSTLEEATSALKNGHSEMLDILAERGGMGMDKLR
SGADGDGFYVRVNTDRIGETNDELDVKQGEIVFVDNTLFMGQHGRWRAWKIDREGRQRQC
GIIPSATVVEASVVRRKTRLPSSSRPHSSLYRPVYERVERISTQQPRPVLLFGAIISPFI
QALLDDPINKFSPCVPECRALSQSELDRLLSSGQIIDARRRDKLYDVISLAAVQSVLDLG
MHVVLDVSPSALHQLRLLRVYPIVIRIKFKSPKQIKELKEELGEKMTSKQAKEIFDKAAI
VDSQLEASDNSGVTVPIGVQTPMKNLVKHICQQTYSRSLHNGICFRSFSFLPITEEAAIP
VKY
Download sequence
Identical sequences H3E3A0
PPA04163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]