SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA05118 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA05118
Domain Number 1 Region: 376-497
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-25
Family Ankyrin repeat 0.0000116
Further Details:      
 
Domain Number 2 Region: 500-576
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000578
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA05118   Protein: PP26359   Gene: WBGene00094672
Sequence length 602
Comment PP26359 WBGene00094672 locus:Ppa-ape-1 status:Partially_confirmed
Sequence
MTAVRAGSSATPTPDAVQRPRASVEPFQIQQMKSPEEAQTSVSPSKEKEGVDETDQRLQH
PPAPSDHLGRTSPHATAAAAAAPGGGGVKIRVVDQQVTMDQQQRVTMTSSSSSVAPNREE
ISPSPPKDPHPTEPGTIAPGPHEPQEPAEHAHARLRGSKADLVSIRSESLKATKRRSWAA
SESTMSELDSIRRVLLEQQLKGRTHYIPDLSPASPAPSSVLSGGVTSSVGGVSSMTIEEE
RREEEEEKAEEPSPFSASSSSSVGAFADSTSAFATTTTSSTSAASAAATAGSSAAGAAAA
EAAAGVERPTALGGVQKEEEPGSSSAEEAGSLCSTRSSEDAAIEMEVQKPSRAVKGILRP
KGKKASGLRIEFDPLALLLDAALEGEIELVQTSAKKLTDVSASNDEGITALHNAICAGHY
EIVRFLIDSNADVNAQDSDGWTPLHCAASCNNLPMVRVLVEGGACVLSSTLSDLETPVQK
CEEEEDGYDGCLRYLIAAHNATGTANGGTVYAAYPYAAEYEDEMSFDGGDKLRVLQKDAP
DTDNGWWLCEKQREDGTTERGLAPRTYLALYPPLKYRQRLAFVPFDFSLESNNNEKDQQQ
QK
Download sequence
Identical sequences H3E5Z1
PPA05118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]