SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA05274 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA05274
Domain Number 1 Region: 18-63
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000798
Family Tandem AAA-ATPase domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA05274   Protein: PP04267   Gene: WBGene00094828
Sequence length 206
Comment PP04267 WBGene00094828 status:Predicted
Sequence
MDQLARRATKFAEGTLVKCKIAYGECAFFQQKKRVEKTQYLVLDEADRMLVMGFAEEVME
IMEKGGIAGKEDLSIALVTLVVWEFDVIHRLHDYEILLPLIRQLAKVLRPSTRMVEGMMA
ASQEETNGADGDSHREGTESTADDASVQTASDDGLLGLACSTRRSHETYLILYGWNTRTV
PTKDLEKAYKNVIKKDQNNFDFYKYT
Download sequence
Identical sequences H3E6E5
PPA05274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]