SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA05494 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA05494
Domain Number 1 Region: 336-423
Classification Level Classification E-value
Superfamily EF-hand 9.07e-16
Family EF-hand modules in multidomain proteins 0.00094
Further Details:      
 
Domain Number 2 Region: 297-335
Classification Level Classification E-value
Superfamily WW domain 0.00000000742
Family WW domain 0.00061
Further Details:      
 
Domain Number 3 Region: 12-116
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000925
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 4 Region: 156-286
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000777
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA05494   Protein: PP14194   Gene: WBGene00095048
Sequence length 431
Comment PP14194 WBGene00095048 status:Predicted
Sequence
MSGKVLEQLERGKERDGLQQRMASLTEAWEATKARCTTIRQQVERAESEWEGLRRKLAEL
LAWTDQQSRDLVNNSAMAGNLSSALHQVTASKNLAKQLEERTPKMKVAIQEANAYLMQHD
LRRKMASGGVLEGEDEMEERDPITAEEQRCGLQLAADVERLKVGWARLQQQHTEWSAVVT
AGAARLQSLERALAECQLGLTGLETELESSKPVEDLRLEQLGAARKDADLLTERVNELRG
QMDEANAASAAVSAADAPLDAHPTNQLEAVNKRYDSLRASTRVRVAAISNALKNLGPSSE
HFLAQSVQLPWQRAVSATNRLPYYIDHKTERTQWDHPAWVELSRELATFNRVKFIAYRTA
MKLRALQKRLCLDLISLDELDKAFSRLDLSSEESISLESMVTCLVPVYEQLHLQQPHVIR
VSHIFLEFACQ
Download sequence
Identical sequences H3E711
PPA05494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]