SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA05495 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA05495
Domain Number 1 Region: 440-517
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000109
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  PPA05495
Domain Number - Region: 111-255
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000173
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA05495   Protein: PP06200   Gene: WBGene00095049
Sequence length 520
Comment PP06200 WBGene00095049 status:Predicted
Sequence
MDADLASAAAIVHAHAMTMEMNESEQAGERIEQLKSDIAHRRQRAIDHRPEWEAFQKILA
EASSDVAALEEEQKKNEEGASEEAFAKTERSVCETVRQLAGVLPRMVEGGKRSEGLRKET
ASLEDRFRAVGYALRETRAKRAAQDVDEAAVCKALEELSRWCSDAAADAAPPPTPANSLD
AAAAKARLQAVLARISQMQAKKATLGRLESDRDRLVSLDRGDTKTKHAIRRGVSETAKQM
SDLRLALAERRADLEAAAEGADEFWKMVDDTARLAAETTRDAEAVCAATVYTPSPAKMDE
VRAGAAELKRRASEMEERMAGAMHEEAPLEEAMRVRVDDVLEACAHAQRAATRMPTPSLM
VESTSDVSTAASFTRQPSVERREERREMEEEEHDQVAEDEETLTLASHWLTEAARDASIT
VDVADTKEVKARSAAILTIIEQLREREREVIGVSDAHAEPTVKQRAHSLLDEMEDLLRRA
ERRRLRLNDLSEESRAFEQARAAMELWLTDGEDVLGTGEC
Download sequence
Identical sequences H3E712
PPA05495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]