SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA05498 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA05498
Domain Number 1 Region: 20-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-21
Family Calponin-homology domain, CH-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 330-438
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-16
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 446-545
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000275
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 513-657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000838
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 5 Region: 614-664,696-797
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000122
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  PPA05498
Domain Number - Region: 984-1046
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000331
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number - Region: 1067-1150
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00236
Family Spectrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA05498   Protein: PP10148   Gene: WBGene00095052
Sequence length 1212
Comment PP10148 WBGene00095052 locus:Ppa-dys-1 status:Predicted
Sequence
MMFEFARKAVLNTWWALVQLFWKRFGPPPINEEKVSEAIRKWCVEAARRYEETAIVDFTS
SWRDGFAFNVLLHSFDPKSISMDAVSAMSAHERLEGAFALAEEKYGVPRLLTIRDLSSEH
LDPRATVTYLMSLYLSLLGRSNVGKSAASSSSSFLTSSSLSAPSSRSPLVLSSDGSEGVT
TVLEQLPVSAVAAAETAAYEAQQMAAAAAAVATAAAAGTAAAAAAAAAAPQERLSRMQQA
HQMRSVDQGTESMITELTWHTEGMPVKDMVSSIRTLSGRTQVPRLTGDGLYLILYRVTSL
QETSTSLRSRKSSSSSQRSSRSRKARKEGLAREFEACLEHVLAWLLEAEEEVESLSDVES
RDVVTVKRQFKEYELLMASLTESQETVGRVLHRGQVLMQRVDDPQEKEQVQQQLVLVNTR
WEQLRELAMARQASLQSRLNALQTSRISEIAAWLTEMEKQVERAEPLADTAEGAVQQIAA
HAQLQQHIDEYQSTIDQLGSFVAVIEEDEEGDASLAALEQRLASIGSRWAALCEWSERRA
GGLDGLVELCQRTELAYATLEEWLKTREQDLLGLRSVHHLETEEEVQNQIVALRTTRDYL
EREHNQIVAVSRLANESVQRLETENGEGANKVRRRLDAINQRWENLVTRVEEQSRMLVQA
GKADKAAVYGEDASRRRRSESASDQEGRAITKVVDRFVQHVTEMEAELGPLREWTNTFTV
SKKPEQVRRMISVCQEKLVEIKEKEAGVARLQLELEHLHMAPRMSARDLKTANDAFHRFN
KSWAKVVTKISEALNVLSGQAEVGEEAEIWDYKQMLLDIPASTQSFVAHGIEEWMEATQR
VLGDVAKIANHEERAARVEKLRAQLTTQRENLAMIQRKMDALGEAPAEERLIKEVDGEWS
SVGDEKQLEEDVVRSEKLVEMARKAEMPADLVERAETRRAEMEERKRVTSTAEHALGVAE
KKIKELSTALATSNDAGVGVAEGWKKLKELRKEMDENEKMRKEAERAAEKMLAVDDGVPK
EVVDRTRARVRALQEGWKGLNERLDESLILAEKEAKKTANKKMGERQRTVDELEKELEES
EKATDAEEYSEHLDNLENLLDKVKQTKADSLADLVQGMDESLVRDNYSKLNESIDRATEK
AEKRIEELAGKAADAEKFEKSAVELGTWAGHIAAILSLRKHADISALDVPAEYKNREIRC
NQDHMAFPVYAG
Download sequence
Identical sequences H3E715
PPA05498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]