SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA05644 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA05644
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-22
Family SH2 domain 0.000051
Further Details:      
 
Domain Number 2 Region: 80-116
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000481
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA05644   Protein: PP10123   Gene: WBGene00095198
Sequence length 120
Comment PP10123 WBGene00095198 status:Predicted
Sequence
MDAEVLLRKQGTHDGAFLVRQCESSPGDFSISVKFEDRIQHFKVLRDNSGKYYLWVVKFS
SLNELVNFHRTSSVSRNQNILLKDMALETQFVQALFDFNPQEDGELAFRRGDIITRQKRP
Download sequence
Identical sequences H3E7F7
PPA05644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]