SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA06400 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA06400
Domain Number 1 Region: 564-649
Classification Level Classification E-value
Superfamily DEATH domain 1.03e-17
Family DEATH domain, DD 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA06400   Protein: PP20456   Gene: WBGene00095954
Sequence length 1193
Comment PP20456 WBGene00095954 locus:Ppa-unc-44 status:Partially_confirmed
Sequence
MDGAPLGVHHITQREQLGGMAPITGGGETDLEQLIRRAQVQPAMTAKHDPSLFESTIPDN
VPIGQNVAQPNFLISFVVDARGGAMRGCRHSGVRIIVPPRKAAAPIRVTCRYLRKDKLAH
PPPLSEGEDLASRILEMAPAGAKFLGPIILEVPHFASLRDREREIVILRSDDGQHWKEHQ
LEATEDAVQEVLNESFDAEELSALEDLNTNRITRVLTNDLPMYFAVVTRVRQEVHCVGPE
GGVITSSVVSRVQAIFPDGSLTKTIKVSVQAQPVPQDIVSRLHGNRVAVSPIVTVEPRRR
KFHKPITLCIPLPQSGNKQMLTQYSGQSGQEPPTLRLLCSITGGSAPAQWEDITGTTQLT
FTGDDVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFTVFARRTFPVEGQ
LRVFCMTDDKEDKTLEKQEHFKEIARSRDVEVLKGKHQFLEFAGNLQPVTKSGEQLSLYF
LPFQENRLAFMVKTRNKDDSEAATEGRIAMMREPRIRAESLPPQAPVCTLAITLPEYTGE
HRVAVKKETKPFEPLEKRYGAALDSPLPDSIHPNVLKGVGGDWQRLARALELPHKDISQI
RAKYPGQEVHHVLRIWIHLKKEEATNDRLDEALRQIGRDDIVRSIQFNELGQLHSDSTHS
LNGLPSKDLSALMPSKDYSKTTPSPRRDDTPSRDSSLAEPSLPLHSTMPSHDEVLIEERH
STPVGGASFTSEPSPVRASHTQSPEVHESHHYVEPIGEEPLEEEAEIEVRTVHRTERHIH
DTDDGPIVEETTVTITYENDEAVKEETHKRTDDLTEEEYEKWNKMHREAERVLNSEEGED
IPEGMHREIREEVEEDGTIVRTTVVTSTYAEEREGDHPVRSVEPVEEENEDEESDADSQK
RVVSGLTSSGDLLLGSIIDGVSLIRVTSDHSLLPSSPTALFEAESWSGEHEEVPHLSEER
RQSLLIDQPHLPSADTPIASSINFERKRTNSLAAALQHIDPSGVPSLSFVRHSGVLLEID
EQGRSPSPNPSISSQGAESIISSLLILLPQVAMSSPSKHSSALERLRQLEDELRESGAVC
PPDAAVSDAVARALAAAPPSTDLQIRVNQSRHTTTTKTVYETETPGMANLDWEKIRELQR
QMIHALCGGGEEGQGTKQKVESMEEGETNEDGSIVVSKKMTRVVTTTRTTAPG
Download sequence
Identical sequences H3E9K6
PPA06400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]