SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA06462 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA06462
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-62
Family Calponin-homology domain, CH-domain 0.00000393
Further Details:      
 
Domain Number 2 Region: 188-247
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-16
Family Spectrin repeat 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA06462   Protein: PP01384   Gene: WBGene00096016
Sequence length 248
Comment PP01384 WBGene00096016 status:Predicted
Sequence
MRIHCLENVDKALQFLKDQHVHLENLGCHDIVDGSPRLTLGLIWTIILRFQIQDITFEDA
DNQETRSAKEALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLIEYNNLQK
SNALFNLQNAFETAENQLQLAKFLDPEDVNVDQPDEKSIITYVVTYYHYFNKLKQENIQG
KRIGKVVNELMENEKMVNKYERISSDLLDWIKARIEVLNERNFINSLEGVQKQLEEFNQY
RTEEKPPX
Download sequence
Identical sequences PPA06462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]