SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA06825 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA06825
Domain Number - Region: 467-500
Classification Level Classification E-value
Superfamily SH3-domain 0.000187
Family SH3-domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA06825   Protein: PP10420   Gene: WBGene00096379
Sequence length 501
Comment PP10420 WBGene00096379 status:Predicted
Sequence
MYGETVVVSYGDHPPTRKVVTDENDFAPVGGPPVPTPAPRVSVSRVEPPVKRDANVVQGA
ILNSEHNTPGKLFNPIRTMAKAQLEKERAALARIEARQKLLPPPVDEIKIVRKKLEPETI
APPMVIPEEPEVLGGEGGDSPGPSPIPLSLSRANLARRANHRTIPEDVPSGIISGIEPGI
GDRSVETTVEGIQSGGARLILTNLTIRAPPSDDEWVQEIYRPKEAQNMLVDRGGQDMGQD
SEYIPEMEQQYDGPAPVQPSFLPRPPQAAPPQKERTALHAPKQPWKLTIRKANFLPGEEL
DDIQIIDQVFAQIIADCKGANAYRIRATERDNVTAILKKHQIHPDQLNRQYEIPTEVKAE
LIAAARKWPLYFNQIFQVVEERATENVSILLAVGETGIRLLLENPGNTQSPLIIQDHFEY
GDIKDVMLEERELITLRTRTNMLVHMRTVEATQIRAIIEKYLYGSAKSRSFVLASSDYIT
NESDHLSFAKGQRIELVEKIH
Download sequence
Identical sequences H3EAS9
PPA06825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]