SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA06877 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA06877
Domain Number 1 Region: 332-403
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-17
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA06877   Protein: PP06864   Gene: WBGene00096431
Sequence length 404
Comment PP06864 WBGene00096431 locus:Ppa-abi-1 status:Partially_confirmed
Sequence
MAQSGTANNRSNGSDLRVLIESRIPDERAGLEDTCANLEKVARYCEENYYNHPDKHAALE
ETKQYALQSLASVAYQIDALSKDLLDMLSLQSDRIGELTTTVSNAAITVDLTKEKQARRE
IGMLTTNKTVPKQQKIIRPDTEEFIGKYKRTPIDFSQLDSVGHGTRSTEQTFLNRSSATM
SRATSSVSGNNSHYGTYSSHYSSPMANMNTLSRATMRSAALSSVQQEHHYRVPQTVPVVD
GSRLSSATSSSRDLYGVNTTLSVNSGYSGDRYGTLRGPPSSSSHYDRGMRTPTLHRLSPV
VHGGANPLLYSGNNDLPPPPPGVSGIDDDLPLPPPPAPVSLFDTQADWVPRDYIERAVAL
YDYEADKADELNLRANCIVYVVRKNEDGWYEGVLNGVTGLFPGR
Download sequence
Identical sequences H3EAY1
PPA06877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]